The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDC639P3 score=192PDB001C9 score=146PD717815 score=484PDC639N6 score=204PD132213 score=182PDC636B9 score=439


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD717815
PDC636B9
PDC639N6
PDC639P3
PD132213
PDB001C9

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD717815
PDC636B9
PDC639N6
PDC639P3
PD132213
PDB001C9

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD717815
PDC636B9
PDC639N6
PDC639P3
PD132213
PDB001C9


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), _quot;Gapped BLAST and PSI-BLAST: a new generation of protein database searchprograms_quot;,  Nucleic Acids Res. 25:3389-3402.Query: unkwown	(304 letters)Database: prodom2010.1 multiple alignments	45,292,438 sequences; 2,147,483,647 total lettersProDom domains producing High-scoring Segment Pairs:  Position  ProDom domain                                      Score E value     24-60  #PDC639P3                                            192 3e-16     62-89  #PDB001C9                                            146 9e-10    90-180  #PD717815                                            484 4e-58   176-294  #PD132213                                            182 4e-14   181-220  #PDC639N6                                            204 5e-18   222-303  #PDC636B9                                            439 2e-51>PD717815 (Closest domain: D8ERN1_ECOLX 327-417)Number of domains in family: 418Commentary (automatic):REDUCTOISOMERASE ALTNAME: BIOSYNTHESIS FULL=KETOL-ACID AMINO-ACID AMINO BRANCHED-CHAIN EC=1.1.1.86 ACID ISOMEROREDUCTASE  Length = 91Score = 484  (191.0 bits), Expect = 4e-58Identities = 91/91 (100%), Positives = 91/91 (100%)
 Query:     90 LSNPAKLRAYALSEQLKEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGK 149               LSNPAKLRAYALSEQLKEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGK Sbjct:    327 LSNPAKLRAYALSEQLKEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGK 386 Query:    150 TAFETAPQYEGKIGEQEYFDKGVLMIAMVKA 180               TAFETAPQYEGKIGEQEYFDKGVLMIAMVKA Sbjct:    387 TAFETAPQYEGKIGEQEYFDKGVLMIAMVKA 417
>PDC636B9 (Closest domain: F4W231_ECOLX 409-490)Number of domains in family: 1311Commentary (automatic):REDUCTOISOMERASE ALTNAME: FULL=KETOL-ACID BIOSYNTHESIS EC=1.1.1.86 AMINO-ACID AMINO BRANCHED-CHAIN ISOMEROREDUCTASE FULL=ALPHA-KETO-BETA-HYDROXYLACIL Length = 82Score = 439 (173.7 bits), Expect = 2e-51Identities = 82/82 (100%), Positives = 82/82 (100%)
 Query:    222 MNVVISDTAEYGNYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNAQLRDVNEAIRSH 281               MNVVISDTAEYGNYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNAQLRDVNEAIRSH Sbjct:    409 MNVVISDTAEYGNYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNAQLRDVNEAIRSH 468 Query:    282 AIEQVGKKLRGYMTDMKRIAVA 303               AIEQVGKKLRGYMTDMKRIAVA Sbjct:    469 AIEQVGKKLRGYMTDMKRIAVA 490
>PDC639N6 (Closest domain: D7YG16_ECOLX 418-457)Number of domains in family: 418Commentary (automatic):REDUCTOISOMERASE ALTNAME: BIOSYNTHESIS FULL=KETOL-ACID AMINO-ACID AMINO BRANCHED-CHAIN EC=1.1.1.86 ACID ISOMEROREDUCTASE Length = 40Score = 204 (83.2 bits), Expect = 5e-18Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 2/40 (5%)
 Query:    181 GVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLY 220               GVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLY Sbjct:    418 GVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLY 457
>PDC639P3 (Closest domain: F0JWU4_ESCFE 211-247)Number of domains in family: 414Commentary (automatic):REDUCTOISOMERASE ALTNAME: BIOSYNTHESIS FULL=KETOL-ACID AMINO-ACID AMINO BRANCHED-CHAIN EC=1.1.1.86 ACID ISOMEROREDUCTASE Length = 37Score = 192 (78.6 bits), Expect = 3e-16Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 3/37 (8%)
 Query:     24 VAEVKSDLMGEQTILCGMLQAGSLLCFDKLVEEGTDP 60               VAEVKSDLMGEQTILCGMLQAGSLLCFDKLVEEGTDP Sbjct:    211 VAEVKSDLMGEQTILCGMLQAGSLLCFDKLVEEGTDP 247
>PD132213 (Closest domain: D3DJS6_HYDTT 204-326)Number of domains in family: 1573Commentary (automatic):REDUCTOISOMERASE ALTNAME: FULL=KETOL-ACID EC=1.1.1.86 ISOMEROREDUCTASE FULL=ALPHA-KETO-BETA-HYDROXYLACIL FULL=ACETOHYDROXY-ACID RECNAME: BIOSYNTHESIS AMINO-ACID Length = 123Score = 182 (74.7 bits), Expect = 4e-14Identities = 51/127 (40%), Positives = 71/127 (55%), Gaps = 15/127 (11%)
 Query:    176 AMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYGNY 235               A++KAG    FET++++G   E AY+E LHEL LI + I +  +  M   ISDTA+YG+  Sbjct:    205 ALIKAG----FETLIEAGYQPEVAYFECLHELKLIVDLIYQYGIAGMRYSISDTAKYGDV 260 Query:    236 LFSYACVPLLKPFMA----ELQPGDLGKAIPEGAVDNAQLRDVNEAI----RSHAIEQVG 287                       L+KP M     E+Q G+  K   E  ++N   R V  A+    R HAIE+VG Sbjct:    261 TRGERIYQLVKPLMKEVLEEIQKGEFAK---EWILENQAGRPVFNALLEKDRKHAIEEVG 317 Query:    288 KKLRGYM 294               +KLR  M Sbjct:    318 EKLREMM 324
>PDB001C9 (Closest domain: C2DYC9_ECOLX 299-326)Number of domains in family: 415Commentary (automatic):REDUCTOISOMERASE ALTNAME: BIOSYNTHESIS FULL=KETOL-ACID AMINO-ACID AMINO BRANCHED-CHAIN EC=1.1.1.86 ACID ISOMEROREDUCTASE Length = 28Score = 146 (60.8 bits), Expect = 9e-10Identities = 28/28 (100%), Positives = 28/28 (100%), Gaps = 10/28 (35%)
 Query:     62 YAEKLIQFGWETITEALKQGGITLMMDR 89               YAEKLIQFGWETITEALKQGGITLMMDR Sbjct:    299 YAEKLIQFGWETITEALKQGGITLMMDR 326


FIG search