The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1125636.3.peg.4313: Escherichia coli 2854350

This feature in The SEED Viewer

NCBI Taxonomy Id: 1125636

Current Assignment: Ketol-acid reductoisomerase (EC 1.1.1.86)
Translate Function Assignments



Context on contig APZL01000139 from base 6867 to 19018 (12152 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4309 6867 8717 1851 +       1: 1   Dihydroxy-acid dehydratase (EC 4.2.1.9) gene_name|ilvD, locus|EC2854350_4138, protein_id|END37820.1, gi|477055056
4310 8720 10264 1545 + 2     1: 1   Threonine dehydratase biosynthetic (EC 4.3.1.19) locus|EC2854350_4139, protein_id|END37821.1, gi|477055057
4311 11209 10316 894 - 51         Transcriptional regulator IlvY, LysR family locus|EC2854350_4140, protein_id|END37822.1, gi|477055058
4312 11359 11850 492 + 149     2: 1 2   Ketol-acid reductoisomerase (EC 1.1.1.86) locus|EC2854350_4141, protein_id|END37823.1, gi|477055059
4313 11920 12834 915 + 69     2: 1 2   Ketol-acid reductoisomerase (EC 1.1.1.86) gene_name|ilvC, locus|EC2854350_4142, protein_id|END37824.1, gi|477055060
4314 13202 12921 282 - 86       dlit(8163020) Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8) gene_name|ppiC, locus|EC2854350_4143, protein_id|END37825.1, gi|477055061
4315 13850 13401 450 - 198         FIG00642180: hypothetical protein locus|EC2854350_4144, protein_id|END37826.1, gi|477055062
4316 14067 16088 2022 + 216         ATP-dependent DNA helicase Rep gene_name|rep, locus|EC2854350_4145, protein_id|END37827.1, gi|477055063
4317 17619 16135 1485 - 46         Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (EC 3.6.1.40) @ Exopolyphosphatase (EC 3.6.1.11) locus|EC2854350_4146, protein_id|END37828.1, gi|477055064
4318 19018 17753 1266 - 133       dlit(8610017)
dlit(12181321)
ATP-dependent RNA helicase RhlB (EC 3.6.4.13) gene_name|rhlB, locus|EC2854350_4147, protein_id|END37829.1, gi|477055065

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CoA_Test Ketol-acid reductoisomerase (EC 1.1.1.86)
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Ketol-acid reductoisomerase (EC 1.1.1.86)


  Protein Sequence

>fig|1125636.3.peg.4313 Ketol-acid reductoisomerase (EC 1.1.1.86)
MAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKLVEEGTDP
AYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQLKEIMAPLFQKHMDDI
ISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEGKIGEQEYFDKGVLMIAMVKA
GVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYGNYLFSYA
CVPLLKPFMAELQPGDLGKAIPEGAVDNAQLRDVNEAIRSHAIEQVGKKLRGYMTDMKRI
AVAG

MD5 = f36fc4e8411ccae52b672d3474df5e3b


  DNA Sequence

>fig|1125636.3.peg.4313 Ketol-acid reductoisomerase (EC 1.1.1.86)
atggcgatcgctaaagcatgggcggcagcaaccggtggtcaccgtgcgggcgtgctggaa
tcgtccttcgttgcggaagtgaaatctgacctgatgggtgagcaaaccatcctgtgcggt
atgttgcaggctggctcgctgctgtgcttcgacaagctggtggaagagggcaccgatccg
gcatacgcagaaaaactaattcagttcggttgggaaaccatcaccgaagcgctgaagcag
ggcggcatcaccctgatgatggaccgtctctctaacccggcgaaactgcgtgcttacgcg
ctgtctgaacagctgaaagagatcatggcacccctgttccagaaacatatggacgacatc
atctccggcgaattctcctccggtatgatggcggactgggccaacgatgataagaaactg
ctgacctggcgtgaagagaccggcaaaaccgccttcgaaaccgcgccgcagtatgaaggc
aaaatcggcgagcaggagtacttcgataaaggcgtactgatgatcgcgatggtgaaagcg
ggcgttgaactggcgttcgaaaccatggtcgattccggcatcattgaagagtctgcatat
tatgaatcactgcacgagctgccgctgattgccaacaccatcgcccgtaagcgtctgtac
gaaatgaacgtggttatctctgataccgctgagtacggtaactatctgttctcttacgct
tgtgtgccgttgctgaaaccgtttatggcagagctgcaaccgggcgacttgggtaaagct
attccggaaggcgcggtagataacgcgcaactgcgtgatgtgaacgaagcgattcgcagc
catgcgattgagcaggtaggtaagaaactgcgcggctatatgacagatatgaaacgtatt
gctgttgcgggttaa


  DNA with Flanking Sequence

>fig|1125636.3.peg.4313 Ketol-acid reductoisomerase (EC 1.1.1.86)
gctttatggggcgcgacgaattcgccgacggcgcgagctaccttcagggtaaaaaagtgg
ttatcgtcggctgtggcgcacaggggctgaaccagggcctgaacatgcgtgattctggtc
tcgatatctcctacgctctgcgtaaagaagcgattgccgagaagcgcgcgtcctggcgta
aagcgaccgaaaacggttttaaagttggtacttacgaagaactgatcccgcaggcggatc
tggtggttaacctgacgccggacaagcagcactctgatgtagtgcgcaccgtacagccac
tgatgaaagacggcgcggcgctgggttactcgcacggtttcaacatcgtcgaagtgggcg
agcagatccgtaaagatatcaccgtagtcatggttgcgccgaaatgccctggcaccgaag
tgcgtgaatagtacaaacgtggattcggcgtaccgacgctgattgccgttcacccggaaa
acgatccgaaaggcgaaggtatggcgatcgctaaagcatgggcggcagcaaccggtggtc
accgtgcgggcgtgctggaatcgtccttcgttgcggaagtgaaatctgacctgatgggtg
agcaaaccatcctgtgcggtatgttgcaggctggctcgctgctgtgcttcgacaagctgg
tggaagagggcaccgatccggcatacgcagaaaaactaattcagttcggttgggaaacca
tcaccgaagcgctgaagcagggcggcatcaccctgatgatggaccgtctctctaacccgg
cgaaactgcgtgcttacgcgctgtctgaacagctgaaagagatcatggcacccctgttcc
agaaacatatggacgacatcatctccggcgaattctcctccggtatgatggcggactggg
ccaacgatgataagaaactgctgacctggcgtgaagagaccggcaaaaccgccttcgaaa
ccgcgccgcagtatgaaggcaaaatcggcgagcaggagtacttcgataaaggcgtactga
tgatcgcgatggtgaaagcgggcgttgaactggcgttcgaaaccatggtcgattccggca
tcattgaagagtctgcatattatgaatcactgcacgagctgccgctgattgccaacacca
tcgcccgtaagcgtctgtacgaaatgaacgtggttatctctgataccgctgagtacggta
actatctgttctcttacgcttgtgtgccgttgctgaaaccgtttatggcagagctgcaac
cgggcgacttgggtaaagctattccggaaggcgcggtagataacgcgcaactgcgtgatg
tgaacgaagcgattcgcagccatgcgattgagcaggtaggtaagaaactgcgcggctata
tgacagatatgaaacgtattgctgttgcgggttaagtgcgcgctgatgccctcaccccga
ccctctcccacagggagagggagaaaacactcaaggccttctcctggagaaggccttgct
attagttgcggtacagcaccttaatgatgtggtaaccgaactgggtgtgcagcgggccgg
tcggctccagtaccggacaagagaacacaactttatcgaacgccggaaccatctgaccct
ggcggaattcacctaaatcaccgccgcgtttgcctgatgggcaaatggagtgtttcttcg
ccagcttgccgaaatcggcaccgttcttaatctgctcgagaagatccagagccagtttct
cttcttttacaaggatatgcagtgctgctgctgtttttgccatgatcgtgccttgagtga
ataattgtcaggcggcgattttagcatgatccgcagatgctaacgtaattgtcagtcagg
gaggggctggtacatatatggcaaaagcccggaaaatccgggcttcgcaggtccc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search