The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1125636.3.peg.4308: Escherichia coli 2854350

This feature in The SEED Viewer

NCBI Taxonomy Id: 1125636

Current Assignment: Branched-chain amino acid aminotransferase (EC 2.6.1.42)
Translate Function Assignments



Context on contig APZL01000139 from base 515 to 11850 (11336 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4303 1354 515 840 -           HTH-type transcriptional regulator hdfR locus|EC2854350_4132, protein_id|END37814.1, gi|477055050
4304 1473 1811 339 + 118         UPF0438 protein YifE locus|EC2854350_4133, protein_id|END37815.1, gi|477055051
4305 3356 1836 1521 - 24         MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein locus|EC2854350_4134, protein_id|END37816.1, gi|477055052
4306 3947 5593 1647 + 590     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|EC2854350_4135, protein_id|END37817.1, gi|477055053
4307 5590 5853 264 + -4     1: 1 dlit(3550695) Acetolactate synthase small subunit (EC 2.2.1.6) gene_name|ilvM, locus|EC2854350_4136, protein_id|END37818.1, gi|477055054
4308 5873 6802 930 + 19     2: 3 1 dlit(9163511)
dlit(3550695)
dlit(3897211)
dlit(3069843)
Branched-chain amino acid aminotransferase (EC 2.6.1.42) gene_name|ilvE, locus|EC2854350_4137, protein_id|END37819.1, gi|477055055
4309 6867 8717 1851 + 64     1: 1   Dihydroxy-acid dehydratase (EC 4.2.1.9) gene_name|ilvD, locus|EC2854350_4138, protein_id|END37820.1, gi|477055056
4310 8720 10264 1545 + 2     1: 1   Threonine dehydratase biosynthetic (EC 4.3.1.19) locus|EC2854350_4139, protein_id|END37821.1, gi|477055057
4311 11209 10316 894 - 51         Transcriptional regulator IlvY, LysR family locus|EC2854350_4140, protein_id|END37822.1, gi|477055058
4312 11359 11850 492 + 149     2: 1 2   Ketol-acid reductoisomerase (EC 1.1.1.86) locus|EC2854350_4141, protein_id|END37823.1, gi|477055059

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
PLP_Y_genes El_Yacoubi_Basma_user Branched-chain amino acid aminotransferase (EC 2.6.1.42)
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Branched-chain amino acid aminotransferase (EC 2.6.1.42)


  Protein Sequence

>fig|1125636.3.peg.4308 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
MTTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR
LHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDV
IIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY
QEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQ
VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDK
WGWLDQVNQ

MD5 = 1d3a670d1bfad1175025fba33bbc4a4c


  DNA Sequence

>fig|1125636.3.peg.4308 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
atgaccacgaagaaagctgattacatttggttcaatggggagatggttcgctgggaagac
gcgaaggtgcatgtgatgtcgcacgcgctgcactatggcacctcggtttttgaaggcatc
cgttgctacgactcacacaaaggaccggttgtattccgccatcgtgagcatatgcagcgt
ctgcatgactccgccaaaatctatcgcttcccggtttcacagagcattgatgagctgatg
gaagcttgtcgtgacgtgatccgcaaaaacaatctcaccagcgcctatatccgtccgctg
atcttcgttggtgatgttggcatgggcgtaaacccgccagcgggatactcaaccgatgtg
attatcgccgctttcccgtggggagcgtatctgggcgcagaagcgctggagcaggggatc
gatgcgatggtttcctcctggaaccgtgcagcaccaaacaccatcccaaccgcggcgaaa
gccggtggtaactatctctcttccctgctggtgggtagtgaagcgcgccgccacggttat
caggaaggtatcgcgctggatgtgaacggttacatctctgaaggcgcaggcgaaaacctg
tttgaagtgaaagacggcgtgctgttcaccccaccgttcacctcctccgcgctgccgggt
attacccgtgatgccatcatcaaactggcaaaagagctgggaattgaagtacgtgagcag
gtgctgtcgcgcgaatccctgtacctggcggatgaagtgtttatgtccggtactgcggca
gaaatcacgccagtgcgcagcgtagacggtattcaggttggcgaaggccgttgtggcccg
gttaccaaacgcattcagcaagccttcttcggcctcttcactggcgaaaccgaagataaa
tggggctggttagatcaagttaatcaataa


  DNA with Flanking Sequence

>fig|1125636.3.peg.4308 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
ccacccttaccgataaccccgattttctcatgttagccagcgccttcggcatccctggcc
aacacatcacccgtaaagaccaggttgaagcggcactcgacaccatgctgaacagtgatg
ggccatacctgcttcatgtctcaatcgacgaacttgagaacgtctggccgctggtgccgc
ctggtgccagtaattcagaaatgttggagaaattatcatgatgcaacatcaggtcaatgt
atcggctcgcttcaatccggaaaccttagaacgtgttttacgcgtggtgcgtcatcgtgg
tttccacgtctgctcaatgaatatggccgccgccagcgatgcacaaaatataaatatcga
attgaccgttgccagcccacggtcggtcgacttactgtttagtcagttaaataaactggt
ggacgtcgcacacgttgccatctgccagagcacaaccacatcacaacaaatccgcgcctg
agcgcaaaaggaatataaaaatgaccacgaagaaagctgattacatttggttcaatgggg
agatggttcgctgggaagacgcgaaggtgcatgtgatgtcgcacgcgctgcactatggca
cctcggtttttgaaggcatccgttgctacgactcacacaaaggaccggttgtattccgcc
atcgtgagcatatgcagcgtctgcatgactccgccaaaatctatcgcttcccggtttcac
agagcattgatgagctgatggaagcttgtcgtgacgtgatccgcaaaaacaatctcacca
gcgcctatatccgtccgctgatcttcgttggtgatgttggcatgggcgtaaacccgccag
cgggatactcaaccgatgtgattatcgccgctttcccgtggggagcgtatctgggcgcag
aagcgctggagcaggggatcgatgcgatggtttcctcctggaaccgtgcagcaccaaaca
ccatcccaaccgcggcgaaagccggtggtaactatctctcttccctgctggtgggtagtg
aagcgcgccgccacggttatcaggaaggtatcgcgctggatgtgaacggttacatctctg
aaggcgcaggcgaaaacctgtttgaagtgaaagacggcgtgctgttcaccccaccgttca
cctcctccgcgctgccgggtattacccgtgatgccatcatcaaactggcaaaagagctgg
gaattgaagtacgtgagcaggtgctgtcgcgcgaatccctgtacctggcggatgaagtgt
ttatgtccggtactgcggcagaaatcacgccagtgcgcagcgtagacggtattcaggttg
gcgaaggccgttgtggcccggttaccaaacgcattcagcaagccttcttcggcctcttca
ctggcgaaaccgaagataaatggggctggttagatcaagttaatcaataaatacaaaaaa
tgggacggcacgcaccgtcccatttacgagacagacactgggagtaaataaagtatgcct
aagtaccgttccgccaccaccactcatggtcgtaatatggcgggtgctcgtgcgctgtgg
cgcgccaccggaatgaccgacgccgattttggcaagccgattatcgcggttgtgaactcg
ttcacccaatttgtaccgggtcacgtccatctgcgcgatctcggtaaactggtcgccgaa
caaattgaagcggctggcggcgttgccaaagagttcaacaccattgcggtggatgatggg
attgccatgggccacggggggatgctttattcacttccatctcgcgaactgatcgctgat
tccgttgagtatatggtcaacgcccactgcgccgacgccatggtctgcatctctaactgt
gacaaaatcaccccggggatgctgatggcctctctgcgcctgaatattccggtgatcttt
gtttccggtg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(3069843);RossO
evidence_code dlit(3550695);RossO
evidence_code dlit(3897211);RossO
evidence_code dlit(9163511);RossO


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search