The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Blast ProDom Result

Please waithttp://prodes.toulouse.inra.fr/prodom/current. Computing.


ProDom Home page Release Home page ProDom forms contact Site map
HELP

Release2012.1

Your ncbi-blastp Query : "unkwown"

 

database:multiple alignments
Program:ncbi-blastp
Matrix:BLOSUM62
Expect:.01
Filter:seq

Graphical results and forms to other applications

The following is the graphical representation of the HSP found by BLAST.
Please note that HSPs are sorted from highest to lowest scores, so that lower scoring HSPs may be hidden.
PDC6K9Z7 score=200PD526846 score=283PD786156 score=316PDA1V4U2 score=145PDA857M8 score=148PD414066 score=281PD482214 score=167PDB197S1 score=231PDB0D1K9 score=156PDA9T8H7 score=235PD869429 score=255PD827414 score=197


Align subsequence with ProDom domains, using Multalin

Domain IDBEGINEND 
PD786156
PD526846
PD414066
PD869429
PDA9T8H7
PDB197S1
PDC6K9Z7
PD827414
PD482214
PDB0D1K9
PDA857M8
PDA1V4U2
PDA026V7
PDA2K3G9
PDB5H8I3
PDC66453
PDA857O4
PDB0F632
PDC7L8T4
PD927405
PDB3L707
PDC657H6
PDA210O4
PDC650L5
PD900101
PD879289
PDC653O7
PDB1O9V8
PDC677U8
PDC69598

Domain 3D modelling using Swiss-Model

Domain IDBEGINEND 
PD786156
PD526846
PD414066
PD869429
PDA9T8H7
PDB197S1
PD827414
PD482214
PDB0D1K9
PDA1V4U2
PDA2K3G9

Domain 3D modelling using Geno3D

Domain IDBEGINEND 
PD786156
PD526846
PD414066
PD869429
PDA9T8H7
PDB197S1
PD827414
PD482214
PDB0D1K9
PDA1V4U2
PDA2K3G9


HSP Results

Warning: Original output has been filtered to yield non-redundant similarities

blastp 2.2.26 [Sep-21-2011]Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), _quot;Gapped BLAST and PSI-BLAST: a new generation of protein database searchprograms_quot;,  Nucleic Acids Res. 25:3389-3402.Query: unkwown	(329 letters)Database: prodom2010.1 multiple alignments	45,292,438 sequences; 2,147,483,647 total lettersProDom domains producing High-scoring Segment Pairs:  Position  ProDom domain                                      Score E value      1-37  #PDC6K9Z7                                            200 3e-17      9-61  #PD526846                                            283 1e-28     43-69  #PDC653O7                                            108 0.0002    46-106  #PD786156                                            316 2e-33     54-78  #PDC69598                                            100 0.003    66-173  #PDC7L8T4                                            129 1e-06    73-120  #PDB5H8I3                                            138 2e-08    76-106  #PDC650L5                                            117 1e-05    77-133  #PDA1V4U2                                            145 3e-09    78-127  #PDA210O4                                            121 4e-06    78-124  #PDB3L707                                            128 5e-07    78-168  #PDA2K3G9                                            141 2e-08   113-167  #PDC66453                                            134 8e-08   113-213  #PDA857M8                                            148 3e-09   122-163  #PDC657H6                                            123 2e-06   122-169  #PDA026V7                                            144 3e-09   126-178  #PD414066                                            281 2e-28   149-174  #PDB1O9V8                                            106 0.0004   149-173  #PDC677U8                                            103 0.0009   170-222  #PD482214                                            167 2e-12   197-240  #PDB197S1                                            231 1e-21   206-273  #PD927405                                            128 7e-07   211-270  #PDB0F632                                            129 5e-07   231-261  #PDB0D1K9                                            156 5e-11   232-275  #PD900101                                            113 6e-05   232-317  #PDA857O4                                            133 2e-07   233-264  #PD879289                                            111 0.0001   254-317  #PDA9T8H7                                            235 7e-22   255-322  #PD869429                                            255 1e-24   270-325  #PD827414                                            197 9e-17>PD786156 (Closest domain: E0IWL7_ECOLW 46-106)Number of domains in family: 1947Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE THREONINE FULL=L-THREONINE  Length = 61Score = 316  (126.3 bits), Expect = 2e-33Identities = 61/61 (100%), Positives = 61/61 (100%)
 Query:     46 LKFENMQRTGSFKIRGAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVM 105               LKFENMQRTGSFKIRGAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVM Sbjct:     46 LKFENMQRTGSFKIRGAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVM 105 Query:    106 P 106               P Sbjct:    106 P 106
>PD526846 (Closest domain: Q32BK0_SHIDS 9-61)Number of domains in family: 939Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=L-THREONINE CATABOLIC THREONINE BETA Length = 53Score = 283 (113.6 bits), Expect = 1e-28Identities = 53/53 (100%), Positives = 53/53 (100%)
 Query:      9 VAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIRG 61               VAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIRG Sbjct:      9 VAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIRG 61
>PD414066 (Closest domain: Q3YXB2_SHISS 126-183)Number of domains in family: 1521Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=L-THREONINE DEHYDRATASE DEAMINASE Length = 58Score = 281 (112.8 bits), Expect = 2e-28Identities = 53/53 (100%), Positives = 53/53 (100%)
 Query:    126 LHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDN 178               LHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDN Sbjct:    126 LHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDN 178
>PD869429 (Closest domain: F4W013_ECOLX 255-322)Number of domains in family: 50Commentary (automatic):SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 CATABOLIC ILVA THREONINE BETA SUBUNIT Length = 68Score = 255 (102.8 bits), Expect = 1e-24Identities = 55/68 (80%), Positives = 55/68 (80%)
 Query:    255 VDDIVLVSEDEIRNSMIALIQRNKVVTEXXXXXXXXXXXXXKLDQYIQNRKTVSIISGGN 314               VDDIVLVSEDEIRNSMIALIQRNKVVTE             KLDQYIQNRKTVSIISGGN Sbjct:    255 VDDIVLVSEDEIRNSMIALIQRNKVVTEGAGALACAALLSGKLDQYIQNRKTVSIISGGN 314 Query:    315 IDLSRVSQ 322               IDLSRVSQ Sbjct:    315 IDLSRVSQ 322
>PDA9T8H7 (Closest domain: E8Y3B9_ECOKO 254-317)Number of domains in family: 658Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE AMMONIA-LYASE FULL=L-THREONINE DEAMINASE Length = 64Score = 235 (95.1 bits), Expect = 7e-22Identities = 51/64 (79%), Positives = 51/64 (79%)
 Query:    254 LVDDIVLVSEDEIRNSMIALIQRNKVVTEXXXXXXXXXXXXXKLDQYIQNRKTVSIISGG 313               LVDDIVLVSEDEIRNSMIALIQRNKVVTE             KLDQYIQNRKTVSIISGG Sbjct:    254 LVDDIVLVSEDEIRNSMIALIQRNKVVTEGAGALACAALLSGKLDQYIQNRKTVSIISGG 313 Query:    314 NIDL 317               NIDL Sbjct:    314 NIDL 317
>PDB197S1 (Closest domain: E8Y3B9_ECOKO 196-240)Number of domains in family: 224Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 CATABOLIC DEHYDRATASE THREONINE FULL=CATABOLIC DEAMINASE Length = 45Score = 231 (93.6 bits), Expect = 1e-21Identities = 44/44 (100%), Positives = 44/44 (100%)
 Query:    197 KSINPTIRVIGVQSENVHGMAASFHSGEITTHRTTGTLADGCDV 240               KSINPTIRVIGVQSENVHGMAASFHSGEITTHRTTGTLADGCDV Sbjct:    197 KSINPTIRVIGVQSENVHGMAASFHSGEITTHRTTGTLADGCDV 240
>PDC6K9Z7 (Closest domain: E0IWL7_ECOLW 1-37)Number of domains in family: 25Commentary (automatic):SUBNAME: DEHYDRATASE FULL=THREONINE CATABOLIC LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT THREONINE Length = 37Score = 200 (81.6 bits), Expect = 3e-17Identities = 37/37 (100%), Positives = 37/37 (100%)
 Query:      1 MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFS 37               MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFS Sbjct:      1 MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFS 37
>PD827414 (Closest domain: H0QEE2_ECOLI 270-325)Number of domains in family: 1184Commentary (automatic):SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 AMMONIA-LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=L-THREONINE Length = 56Score = 197 (80.5 bits), Expect = 9e-17Identities = 43/56 (76%), Positives = 43/56 (76%)
 Query:    270 MIALIQRNKVVTEXXXXXXXXXXXXXKLDQYIQNRKTVSIISGGNIDLSRVSQITG 325               MIALIQRNKVVTE             KLDQYIQNRKTVSIISGGNIDLSRVSQITG Sbjct:    270 MIALIQRNKVVTEGAGALACAALLSGKLDQYIQNRKTVSIISGGNIDLSRVSQITG 325
>PD482214 (Closest domain: F4W013_ECOLX 170-222)Number of domains in family: 1906Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE FULL=PUTATIVE DEHYDRATASE FULL=L-THREONINE Length = 53Score = 167 (68.9 bits), Expect = 2e-12Identities = 35/53 (66%), Positives = 35/53 (66%), Gaps = 5/53 (9%)
 Query:    170 MEDLYDVDNXXXXXXXXXXXXXXXXXXKSINPTIRVIGVQSENVHGMAASFHS 222               MEDLYDVDN                  KSINPTIRVIGVQSENVHGMAASFHS Sbjct:    170 MEDLYDVDNVIVPIGGGGLIAGIAVAIKSINPTIRVIGVQSENVHGMAASFHS 222
>PDB0D1K9 (Closest domain: H0QEE2_ECOLI 231-261)Number of domains in family: 538Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE DEAMINASE FULL=L-THREONINE DEHYDRATASE Length = 31Score = 156 (64.7 bits), Expect = 5e-11Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 5/31 (16%)
 Query:    231 TGTLADGCDVSRPGNLTYEIVRELVDDIVLV 261               TGTLADGCDVSRPGNLTYEIVRELVDDIVLV Sbjct:    231 TGTLADGCDVSRPGNLTYEIVRELVDDIVLV 261
>PDA857M8 (Closest domain: D1C1H4_SPHTD 113-225)Number of domains in family: 57Commentary (automatic):SUBNAME: BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT LYASE FULL=THREONINE FULL=PUTATIVE EC=4.3.1.19 DEHYDRATASE UNCHARACTERIZED Length = 113Score = 148 (61.6 bits), Expect = 3e-09Identities = 37/101 (36%), Positives = 53/101 (52%), Gaps = 2/101 (1%)
 Query:    113 KVAATCDYSAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMED 172               KVA+     AEVVL G +F++      E  E +G  +I   ++P +IAG GT  LE++E  Sbjct:    116 KVASMRRLGAEVVLTGRDFDEARLAAEERAERDGMRYIHSANEPDLIAGVGTYALEMIEA 175 Query:    173 LYDVDNXXXXXXXXXXXXXXXXXXKSINPTIRVIGVQSENV 213               + D+D                   K++NP IRVIGVQSE + Sbjct:    176 VPDLDTVIVPVGAGSGVCGTAIVMKAVNPAIRVIGVQSEEM 216
>PDA1V4U2 (Closest domain: A0Q0J5_CLONN 71-128)Number of domains in family: 465Commentary (automatic):SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE EC=4.3.1.15 FULL=PUTATIVE FULL=THREONINE SYNTHASE DEHYDRATASE EC=4.3.1.19 Length = 58Score = 145 (60.5 bits), Expect = 3e-09Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 2/57 (3%)
 Query:     77 GVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLHGDNFND 133               GV+A SAGNHAQGV+ +    G+   +VMP  AP++KV AT  Y AEVV +G  +++ Sbjct:     71 GVIASSAGNHAQGVAYAATAFGVKSTIVMPATAPQAKVEATKGYGAEVVQYGQVYDE 127
>PDA026V7 (Closest domain: G7WNS1_METH6 121-167)Number of domains in family: 680Commentary (automatic):SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT FULL=PUTATIVE AMMONIA-LYASE Length = 47Score = 144 (60.1 bits), Expect = 3e-09Identities = 30/48 (62%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Query:    122 AEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEI 169               AEV+L GD+  ++I+   E+ E EGR FI PYDDP +IAGQGTIGLEI Sbjct:    121 AEVILAGDSLAESISIAREMAE-EGRPFIHPYDDPDIIAGQGTIGLEI 167
>PDA2K3G9 (Closest domain: SRR_BOVIN 79-169)Number of domains in family: 166Commentary (automatic):SUBNAME: LYASE AMMONIA-LYASE FULL=DIAMINOPROPIONATE FULL=PUTATIVE EC=4.3.1.15 DEHYDRATASE UNCHARACTERIZED ALTNAME: EC=4.3.1.19 Length = 91Score = 141 (58.9 bits), Expect = 2e-08Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Query:     78 VVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVL--HGDNFNDTI 135               VVA S+GNH Q +S +  + GI   V++P+ AP  K  A   Y A +V     +   + I Sbjct:     79 VVAHSSGNHGQALSFAARLEGIPAYVIVPETAPNCKKLAIQAYGASIVYSEQSEESRENI 138 Query:    136 AK-VSEIVEMEGRIFIPPYDDPKVIAGQGTIGLE 168                K ++E  E EG I + P  +P VIAGQGTI +E Sbjct:    139 TKRIAE--ETEG-IMVHPNQEPAVIAGQGTIAME 169
>PDB5H8I3 (Closest domain: Q1BNJ8_BURCA 67-119)Number of domains in family: 262Commentary (automatic):SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PUTATIVE BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT SUBUNIT AMMONIA-LYASE Length = 53Score = 138 (57.8 bits), Expect = 2e-08Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 6/48 (12%)
 Query:     73 EKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDY 120               ++R GVVA S+GNHAQ V+LS  +LGI   +VMP+ AP +K+AAT  Y Sbjct:     71 QRRHGVVAFSSGNHAQAVALSARILGIPATIVMPQDAPAAKMAATRGY 118
>PDC66453 (Closest domain: F0Q1X2_ACIAP 105-160)Number of domains in family: 110Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 56Score = 134 (56.2 bits), Expect = 8e-08Identities = 28/55 (50%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Query:    113 KVAATCDYSAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGL 167               KV  T  +SAEVVLHGD   +  A    + E  G  F+ PYDD  V AGQGT+GL Sbjct:    106 KVERTRGFSAEVVLHGDTLEEARAHAYALAEERGLTFVHPYDDEAVAAGQGTVGL 160
>PDA857O4 (Closest domain: E1V5I0_HALED 224-308)Number of domains in family: 91Commentary (automatic):SUBNAME: LYASE DEHYDRATASE BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE FULL=THREONINE EC=4.3.1.19 THREONINE Length = 85Score = 133 (55.8 bits), Expect = 2e-07Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Query:    232 GTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVVTEXXXXXXXXX 291                TLA+G  V +PG LT E+VRELV DI LV E EI  +++ L++  K V E          Sbjct:    224 ATLAEGIAVKQPGELTRELVRELVSDITLVDEPEIERAILMLLEIEKTVAEGAGAAGLAA 283 Query:    292 XXXXKLDQYIQNRKTVSIISGGNIDL 317                      +  + RK   ++ GGNID+ Sbjct:    284 LLTEP--ERYRGRKVGLVLCGGNIDM 307
>PDB0F632 (Closest domain: A4FF54_SACEN 203-263)Number of domains in family: 53Commentary (automatic):SUBNAME: DEHYDRATASE FULL=THREONINE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT LYASE EC=4.3.1.19 THREONINE FULL=PUTATIVE Length = 61Score = 129 (54.3 bits), Expect = 5e-07Identities = 28/60 (46%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Query:    211 ENVHGMAASFHSGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSM 270               ++V    ++ H  EI   RT   +ADG  ++ PG LT+E+VR LVD++VLVS+DEIR +M Sbjct:    207 DDVRRSLSAGHRVEIPVPRT---IADGQAITAPGELTFEVVRRLVDEVVLVSDDEIRAAM 263
>PDC7L8T4 (Closest domain: F2RQJ5_TRIT1 85-200)Number of domains in family: 8Commentary (automatic):SUBNAME: SYNTHETASE AMINOACYL-TRNA FULL=PUTATIVE UNCHARACTERIZED NUCLEOTIDE-BINDING FULL=BIFUNCTIONAL ATP-BINDING LIGASE BIOSYNTHESIS Length = 116Score = 129 (54.3 bits), Expect = 1e-06Identities = 36/114 (31%), Positives = 55/114 (48%), Gaps = 6/114 (5%)
 Query:     66 LSSLTDAEKRKGVVACSAGNHA----QGVSLSCAMLGIDGKV--VMPKGAPKSKVAATCD 119               LS ++D   ++G+V  S GNHA       SL   M GI   V   MP  A K+KV      Sbjct:     85 LSRMSDERLKRGIVVFSTGNHAFASGYAASLLSRMRGIQIPVHAFMPPTASKTKVYLAES 144 Query:    120 YSAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDL 173                  +V L G++  + +       E  G   + P DD  +I G G++G+EI++ + Sbjct:    145 QGVQVHLSGNSVTECMRIAEAFAESLGTSVLAPADDYDIIRGHGSVGIEIIDQM 198
>PD927405 (Closest domain: F9Z5X0_ODOSD 208-277)Number of domains in family: 543Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC AMMONIA-LYASE DEHYDRATASE FULL=L-THREONINE THREONINE Length = 70Score = 128 (53.9 bits), Expect = 7e-07Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Query:    206 IGVQSENVHGMAASFHSGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDE 265               IGV+     GM  SF  GE+T         DG  V R G LTY I ++++DDIV+V E + Sbjct:    208 IGVEPAGAAGMKKSFECGEVTELNEVDKFVDGAAVQRVGELTYAICKKVLDDIVVVPEGK 267 Query:    266 IRNSMIAL 273               I  +++ L Sbjct:    268 ICTTILNL 275
>PDB3L707 (Closest domain: D8HM05_AMYMU 73-119)Number of domains in family: 12Commentary (automatic):SUBNAME: SCAFFOLD BIOSYNTHESIS FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT REFERENCE FULL=PUTATIVE UNCHARACTERIZED BETA SUBUNIT CYSTEINE Length = 47Score = 128 (53.9 bits), Expect = 5e-07Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Query:     78 VVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEV 124               VVA SAGNHAQGV+L+ ++LG    V MP  AP  K+AAT  Y A+V Sbjct:     73 VVAASAGNHAQGVALASSLLGAKSTVFMPLRAPLPKLAATRGYGADV 119
>PDC657H6 (Closest domain: B9TLI3_RICCO 26-67)Number of domains in family: 135Commentary (automatic):SUBNAME: FULL=THREONINE LYASE EC=4.3.1.19 DEHYDRATASE AMMONIA-LYASE FULL=L-THREONINE BIOSYNTHETIC EC=4.3.1.17 DEHYDRATASE Length = 42Score = 123 (52.0 bits), Expect = 2e-06Identities = 23/42 (54%), Positives = 30/42 (71%), Gaps = 2/42 (4%)
 Query:    122 AEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQG 163               AEVVL GD+++D  A   ++ + EG  F+ PYDDP VIAGQG Sbjct:     26 AEVVLFGDSYSDAYAHALKVEQTEGLTFVHPYDDPDVIAGQG 67
>PDA210O4 (Closest domain: B9LBZ4_CHLSY 73-122)Number of domains in family: 232Commentary (automatic):SUBNAME: DEHYDRATASE FULL=PUTATIVE FULL=L-SERINE LYASE UNCHARACTERIZED EC=4.3.1.19 EC=4.3.1.17 BETA FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 50Score = 121 (51.2 bits), Expect = 4e-06Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 6/50 (12%)
 Query:     78 VVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLH 127               VVACSAGNHA GV+ + A+ G    +V+P  A  +KV A   Y  EV+LH Sbjct:     73 VVACSAGNHALGVAHTAALTGTPATLVVPTTASPAKVTALRRYPVEVILH 122
>PDC650L5 (Closest domain: E3ECZ9_PAEPS 102-135)Number of domains in family: 178Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC FULL=L-THREONINE BIOSYNTHESIS AMMONIA-LYASE ILVA Length = 34Score = 117 (49.7 bits), Expect = 1e-05Identities = 21/31 (67%), Positives = 24/31 (77%), Gaps = 1/31 (3%)
 Query:     76 KGVVACSAGNHAQGVSLSCAMLGIDGKVVMP 106               KG+V  SAGNHAQGV+ SC  LGI GK+ MP Sbjct:    103 KGIVCASAGNHAQGVAFSCNALGIHGKIFMP 133
>PD900101 (Closest domain: Q095H4_STIAD 221-270)Number of domains in family: 68Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE FULL=PUTATIVE REFERENCE UNCHARACTERIZED EC=4.3.1.19 LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA Length = 50Score = 113 (48.1 bits), Expect = 6e-05Identities = 20/44 (45%), Positives = 34/44 (77%), Gaps = 2/44 (4%)
 Query:    232 GTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQ 275                T+A+G  V +PG+LT+ +VR+ VD+IV V E+EI N+++ L++ Sbjct:    227 ATIAEGISVRKPGDLTFPMVRKYVDEIVTVDEEEIANAILVLLE 270
>PD879289 (Closest domain: B8HEW2_ARTCA 236-269)Number of domains in family: 505Commentary (automatic):SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 BETA SUBUNIT FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT FULL=PUTATIVE AMMONIA-LYASE Length = 34Score = 111 (47.4 bits), Expect = 0.0001Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Query:    233 TLADGCDVSRPGNLTYEIVRELVDDIVLVSED 264               T+ADG  V RPG L + I+RELVDD+V VSED Sbjct:    237 TMADGIAVGRPGQLPFSIIRELVDDVVTVSED 268
>PDC653O7 (Closest domain: C3K9W5_PSEFS 38-67)Number of domains in family: 155Commentary (automatic):SUBNAME: DEHYDRATASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT BETA SUBUNIT LYASE FULL=THREONINE FULL=PUTATIVE DEPENDENT FULL=PYRIDOXAL-PHOSPHATE Length = 30Score = 108 (46.2 bits), Expect = 0.0002Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 3/27 (11%)
 Query:     43 EIFLKFENMQRTGSFKIRGAFNKLSSL 69               E+F+K EN+QRTGSFK RGAFN LS   Sbjct:     38 EVFIKCENLQRTGSFKFRGAFNALSQF 64
>PDB1O9V8 (Closest domain: D8UL90_VOLCA 320-349)Number of domains in family: 22Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE REFERENCE FULL=PUTATIVE UNCHARACTERIZED SHOTGUN LYASE GENOME SEQUENCE Length = 30Score = 106 (45.4 bits), Expect = 0.0004Identities = 19/26 (73%), Positives = 21/26 (80%), Gaps = 1/26 (3%)
 Query:    149 FIPPYDDPKVIAGQGTIGLEIMEDLY 174               FIPPYDDP  IAGQGTIG EIM+  + Sbjct:    320 FIPPYDDPYTIAGQGTIGDEIMQQTH 345
>PDC677U8 (Closest domain: F8F796_PAEMK 152-177)Number of domains in family: 81Commentary (automatic):SUBNAME: FULL=THREONINE DEHYDRATASE LYASE EC=4.3.1.19 BIOSYNTHETIC DEHYDRATASE THREONINE FULL=PUTATIVE ILVA Length = 26Score = 103 (44.3 bits), Expect = 0.0009Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 1/25 (4%)
 Query:    149 FIPPYDDPKVIAGQGTIGLEIMEDL 173               FI P+DD KV+AGQGT+GLE+M DL Sbjct:    153 FIHPFDDHKVVAGQGTVGLELMNDL 177
>PDC69598 (Closest domain: B8CWL8_HALOH 48-72)Number of domains in family: 61Commentary (automatic):SUBNAME: DEHYDRATASE FULL=THREONINE LYASE EC=4.3.1.19 FULL=PUTATIVE THREONINE UNCHARACTERIZED AMMONIA-LYASE FULL=PYRIDOXAL-5_apos;-PHOSPHATE-DEPENDENT Length = 25Score = 100 (43.1 bits), Expect = 0.003Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 1/25 (4%)
 Query:     54 TGSFKIRGAFNKLSSLTDAEKRKGV 78               TGSFKIRGAFNK++ L+D EKR GV Sbjct:     48 TGSFKIRGAFNKIACLSDEEKRHGV 72


FIG search