The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.3553: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Turn Off Function Translation



Context on contig APYN01000064 from base 119022 to 127892 (8871 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3549 119411 119022 390 -       1: 2 dlit(9484901) 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10) gene_name|tdcF, locus|ECP02999174_3617, protein_id|ENC53854.1, gi|476966126
3550 121719 119425 2295 - 13         2-ketobutyrate formate-lyase (EC 2.3.1.-) / Pyruvate formate-lyase (EC 2.3.1.54) locus|ECP02999174_3618, protein_id|ENC53855.1, gi|476966127
3551 122961 121753 1209 - 33         Acetate kinase (EC 2.7.2.1) @ Propionate kinase (EC 2.7.2.15) locus|ECP02999174_3619, protein_id|ENC53856.1, gi|476966128
3552 124318 122987 1332 - 25         L-threonine transporter, anaerobically inducible locus|ECP02999174_3620, protein_id|ENC53857.1, gi|476966129
3553 125329 124340 990 - 21     1: 1 dlit(9484901) Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17) locus|ECP02999174_3621, protein_id|ENC53858.1, gi|476966130
3554 126366 125428 939 - 98       dlit(9484901) Threonine catabolic operon transcriptional activator TdcA locus|ECP02999174_3622, protein_id|ENC53859.1, gi|476966131
3555 126555 126899 345 + 188         Threonine catabolic operon transcriptional activator TdcR locus|ECP02999174_3623, protein_id|ENC53860.1, gi|476966132
3556 127155 127694 540 + 255         orf, hypothetical protein locus|ECP02999174_3624, protein_id|ENC53861.1, gi|476966133
3557 127716 127892 177 + 21         hypothetical protein locus|ECP02999174_3625, protein_id|ENC53862.1, gi|476966134

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Threonine dehydratase, catabolic (EC 4.3.1.19)


  Protein Sequence

>fig|1116050.3.peg.3553 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIR
GAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDY
SAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVI
VPIGGGGLIAGIAVAIKSINPTIRVIGVQSENVHGMAASFHSGEITTHRTTGTLADGCDV
SRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVVTEGAGALACAALLSGKLDQY
IQNRKTVSIISGGNIDLSRVSQITGFVDA

MD5 = 994df575ca9a00e2f723808a842887e5


  DNA Sequence

>fig|1116050.3.peg.3553 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
atgcatattacatacgatctgccggttgctattgatgacattattgaagcgaaacaacga
ctggctgggcgaatttataaaacaggcatgcctcgctcaaactattttagtgaacgttgc
aaaggtgaaatattcctgaagtttgaaaatatgcagcgtacgggttcatttaaaattcgt
ggcgcatttaataaattaagttcactgactgatgcggaaaaacgtaaaggtgtagtggcc
tgttctgcgggcaaccatgcgcaaggggtttcgctctcctgcgcgatgctgggtatcgac
ggtaaagtggtgatgccaaaaggtgcgccaaaatccaaagtagcggcaacgtgcgactac
tccgcagaagtcgttctgcatggtgataatttcaacgacactatcgctaaagtgagcgaa
attgtcgaaatggaaggtcgtatttttatcccaccttacgatgatccgaaagtgattgct
ggccagggaacgattggtctggaaattatggaagatctctatgatgtcgataacgtgatt
gtgccaattggtggtggtggtttaattgctggtattgcggtggcaattaaatctattaac
ccgaccattcgtgttattggcgtacagtcagaaaacgttcacggcatggcggcttctttc
cactccggagaaataaccacgcaccgaactaccggcaccctggcggatggttgtgatgtc
tcccgcccgggtaatttaacttacgaaatcgttcgtgaattagtcgatgacatcgtgctg
gtcagcgaagacgaaatcagaaacagtatgattgccttaattcagcgcaataaagtcgtc
accgaaggcgcaggcgctctggcatgtgctgcattattaagcggtaaattagaccaatat
attcaaaacagaaaaaccgtcagtattatttccggcggcaatatcgatctttctcgcgtc
tctcaaatcaccggtttcgttgacgcttaa


  DNA with Flanking Sequence

>fig|1116050.3.peg.3553 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
tcccgaacatgcaccggcaccaccacgctggagtcgttgaagaacgaacagtgggtgttg
ccacaaaccaatatggggtactacagcgagcttcttactacgttacaaagaaatggcatc
agtattgaaaacatcgttaaaaccgactcagtcgtgacaatttataatcttgttctcaat
gctgatttcttaactgtaattccttgtgatatgacgtcaccttttggttcaaatcaattt
attactattccggttgaagaaacattacctgtggcacaatatgccgcggtatggtcgaaa
aattatcgtattaaaaaagcagcatcggttttggtggaattagccaaagagtattcatct
tataatgggtgtagacgaaggcaattaatagaagttggttagttatttgtttttatttaa
acataaataatccacctgtctgttttgcaggtgtcggttacggttacctacatatttaat
tcaggcgaagaggttttataatgcatattacatacgatctgccggttgctattgatgaca
ttattgaagcgaaacaacgactggctgggcgaatttataaaacaggcatgcctcgctcaa
actattttagtgaacgttgcaaaggtgaaatattcctgaagtttgaaaatatgcagcgta
cgggttcatttaaaattcgtggcgcatttaataaattaagttcactgactgatgcggaaa
aacgtaaaggtgtagtggcctgttctgcgggcaaccatgcgcaaggggtttcgctctcct
gcgcgatgctgggtatcgacggtaaagtggtgatgccaaaaggtgcgccaaaatccaaag
tagcggcaacgtgcgactactccgcagaagtcgttctgcatggtgataatttcaacgaca
ctatcgctaaagtgagcgaaattgtcgaaatggaaggtcgtatttttatcccaccttacg
atgatccgaaagtgattgctggccagggaacgattggtctggaaattatggaagatctct
atgatgtcgataacgtgattgtgccaattggtggtggtggtttaattgctggtattgcgg
tggcaattaaatctattaacccgaccattcgtgttattggcgtacagtcagaaaacgttc
acggcatggcggcttctttccactccggagaaataaccacgcaccgaactaccggcaccc
tggcggatggttgtgatgtctcccgcccgggtaatttaacttacgaaatcgttcgtgaat
tagtcgatgacatcgtgctggtcagcgaagacgaaatcagaaacagtatgattgccttaa
ttcagcgcaataaagtcgtcaccgaaggcgcaggcgctctggcatgtgctgcattattaa
gcggtaaattagaccaatatattcaaaacagaaaaaccgtcagtattatttccggcggca
atatcgatctttctcgcgtctctcaaatcaccggtttcgttgacgcttaattaattcgtt
gaggataggatatgagtacttcagatagcattgtatccagccagacaaaacaatcgtcct
ggcgtaaatcagataccacatggacgttaggcttgtttggtacggcaatcggcgccgggg
tgctgttcttccctatccgcgcaggttttggcggactgatcccgattcttctgatgttgg
tattggcataccccatcgcattttattgccaccgggcgctggcgcgtctgtgtctttctg
gctctaacccttccggcaacattacggaaacggtggaagagcattttggtaaaactggcg
gcgtggttatcacgttcctgtacttcttcgcgatttgcccactgctgtggatttatggcg
ttactattaccaatacctttatgacgttctgggaaaaccagctcggatttgcaccgctga
atcgcggctttgtggcgctgttcctgttgctgctgatggctttcgtcatctggtttggta
aggatctgat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(9484901);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search