The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.3553: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Translate Function Assignments



Context on contig APYN01000064 from base 119022 to 127892 (8871 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3549 119411 119022 390 -       1: 2 dlit(9484901) 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10) gene_name|tdcF, locus|ECP02999174_3617, protein_id|ENC53854.1, gi|476966126
3550 121719 119425 2295 - 13         2-ketobutyrate formate-lyase (EC 2.3.1.-) / Pyruvate formate-lyase (EC 2.3.1.54) locus|ECP02999174_3618, protein_id|ENC53855.1, gi|476966127
3551 122961 121753 1209 - 33         Acetate kinase (EC 2.7.2.1) @ Propionate kinase (EC 2.7.2.15) locus|ECP02999174_3619, protein_id|ENC53856.1, gi|476966128
3552 124318 122987 1332 - 25         L-threonine transporter, anaerobically inducible locus|ECP02999174_3620, protein_id|ENC53857.1, gi|476966129
3553 125329 124340 990 - 21     1: 1 dlit(9484901) Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17) locus|ECP02999174_3621, protein_id|ENC53858.1, gi|476966130
3554 126366 125428 939 - 98       dlit(9484901) Threonine catabolic operon transcriptional activator TdcA locus|ECP02999174_3622, protein_id|ENC53859.1, gi|476966131
3555 126555 126899 345 + 188         Threonine catabolic operon transcriptional activator TdcR locus|ECP02999174_3623, protein_id|ENC53860.1, gi|476966132
3556 127155 127694 540 + 255         orf, hypothetical protein locus|ECP02999174_3624, protein_id|ENC53861.1, gi|476966133
3557 127716 127892 177 + 21         hypothetical protein locus|ECP02999174_3625, protein_id|ENC53862.1, gi|476966134

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Threonine dehydratase, catabolic (EC 4.3.1.19)


  Protein Sequence

>fig|1116050.3.peg.3553 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIR
GAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDY
SAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVI
VPIGGGGLIAGIAVAIKSINPTIRVIGVQSENVHGMAASFHSGEITTHRTTGTLADGCDV
SRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVVTEGAGALACAALLSGKLDQY
IQNRKTVSIISGGNIDLSRVSQITGFVDA

MD5 = 994df575ca9a00e2f723808a842887e5


  DNA Sequence

>fig|1116050.3.peg.3553 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
atgcatattacatacgatctgccggttgctattgatgacattattgaagcgaaacaacga
ctggctgggcgaatttataaaacaggcatgcctcgctcaaactattttagtgaacgttgc
aaaggtgaaatattcctgaagtttgaaaatatgcagcgtacgggttcatttaaaattcgt
ggcgcatttaataaattaagttcactgactgatgcggaaaaacgtaaaggtgtagtggcc
tgttctgcgggcaaccatgcgcaaggggtttcgctctcctgcgcgatgctgggtatcgac
ggtaaagtggtgatgccaaaaggtgcgccaaaatccaaagtagcggcaacgtgcgactac
tccgcagaagtcgttctgcatggtgataatttcaacgacactatcgctaaagtgagcgaa
attgtcgaaatggaaggtcgtatttttatcccaccttacgatgatccgaaagtgattgct
ggccagggaacgattggtctggaaattatggaagatctctatgatgtcgataacgtgatt
gtgccaattggtggtggtggtttaattgctggtattgcggtggcaattaaatctattaac
ccgaccattcgtgttattggcgtacagtcagaaaacgttcacggcatggcggcttctttc
cactccggagaaataaccacgcaccgaactaccggcaccctggcggatggttgtgatgtc
tcccgcccgggtaatttaacttacgaaatcgttcgtgaattagtcgatgacatcgtgctg
gtcagcgaagacgaaatcagaaacagtatgattgccttaattcagcgcaataaagtcgtc
accgaaggcgcaggcgctctggcatgtgctgcattattaagcggtaaattagaccaatat
attcaaaacagaaaaaccgtcagtattatttccggcggcaatatcgatctttctcgcgtc
tctcaaatcaccggtttcgttgacgcttaa


  DNA with Flanking Sequence

>fig|1116050.3.peg.3553 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
tcccgaacatgcaccggcaccaccacgctggagtcgttgaagaacgaacagtgggtgttg
ccacaaaccaatatggggtactacagcgagcttcttactacgttacaaagaaatggcatc
agtattgaaaacatcgttaaaaccgactcagtcgtgacaatttataatcttgttctcaat
gctgatttcttaactgtaattccttgtgatatgacgtcaccttttggttcaaatcaattt
attactattccggttgaagaaacattacctgtggcacaatatgccgcggtatggtcgaaa
aattatcgtattaaaaaagcagcatcggttttggtggaattagccaaagagtattcatct
tataatgggtgtagacgaaggcaattaatagaagttggttagttatttgtttttatttaa
acataaataatccacctgtctgttttgcaggtgtcggttacggttacctacatatttaat
tcaggcgaagaggttttataatgcatattacatacgatctgccggttgctattgatgaca
ttattgaagcgaaacaacgactggctgggcgaatttataaaacaggcatgcctcgctcaa
actattttagtgaacgttgcaaaggtgaaatattcctgaagtttgaaaatatgcagcgta
cgggttcatttaaaattcgtggcgcatttaataaattaagttcactgactgatgcggaaa
aacgtaaaggtgtagtggcctgttctgcgggcaaccatgcgcaaggggtttcgctctcct
gcgcgatgctgggtatcgacggtaaagtggtgatgccaaaaggtgcgccaaaatccaaag
tagcggcaacgtgcgactactccgcagaagtcgttctgcatggtgataatttcaacgaca
ctatcgctaaagtgagcgaaattgtcgaaatggaaggtcgtatttttatcccaccttacg
atgatccgaaagtgattgctggccagggaacgattggtctggaaattatggaagatctct
atgatgtcgataacgtgattgtgccaattggtggtggtggtttaattgctggtattgcgg
tggcaattaaatctattaacccgaccattcgtgttattggcgtacagtcagaaaacgttc
acggcatggcggcttctttccactccggagaaataaccacgcaccgaactaccggcaccc
tggcggatggttgtgatgtctcccgcccgggtaatttaacttacgaaatcgttcgtgaat
tagtcgatgacatcgtgctggtcagcgaagacgaaatcagaaacagtatgattgccttaa
ttcagcgcaataaagtcgtcaccgaaggcgcaggcgctctggcatgtgctgcattattaa
gcggtaaattagaccaatatattcaaaacagaaaaaccgtcagtattatttccggcggca
atatcgatctttctcgcgtctctcaaatcaccggtttcgttgacgcttaattaattcgtt
gaggataggatatgagtacttcagatagcattgtatccagccagacaaaacaatcgtcct
ggcgtaaatcagataccacatggacgttaggcttgtttggtacggcaatcggcgccgggg
tgctgttcttccctatccgcgcaggttttggcggactgatcccgattcttctgatgttgg
tattggcataccccatcgcattttattgccaccgggcgctggcgcgtctgtgtctttctg
gctctaacccttccggcaacattacggaaacggtggaagagcattttggtaaaactggcg
gcgtggttatcacgttcctgtacttcttcgcgatttgcccactgctgtggatttatggcg
ttactattaccaatacctttatgacgttctgggaaaaccagctcggatttgcaccgctga
atcgcggctttgtggcgctgttcctgttgctgctgatggctttcgtcatctggtttggta
aggatctgat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(9484901);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search