The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116007.3.peg.4691: Escherichia coli 2731150

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116007

Current Assignment: Branched-chain amino acid aminotransferase (EC 2.6.1.42)
Turn Off Function Translation



Context on contig AQEB01000175 from base 15316 to 27886 (12571 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4684 16203 15316 888 -           FIG00639870: hypothetical protein locus|EC2731150_4367, protein_id|EMW72981.1, gi|476254214
4685 16444 16256 189 - 52         COG3311: Predicted transcriptional regulator locus|EC2731150_4368, protein_id|EMW72982.1, gi|476254215
4686 16524 16649 126 + 79         hypothetical protein locus|EC2731150_4369, protein_id|EMW72983.1, gi|476254216
4687 18050 16821 1230 - 171         Mobile element protein locus|EC2731150_4371, protein_id|EMW72985.1, gi|476254218
4688 18408 18229 180 - 178         MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein locus|EC2731150_4372, protein_id|EMW72986.1, gi|476254219
4689 18999 20645 1647 + 590     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|EC2731150_4373, protein_id|EMW72987.1, gi|476254220
4690 20642 20905 264 + -4     1: 1 dlit(3550695) Acetolactate synthase small subunit (EC 2.2.1.6) gene_name|ilvM, locus|EC2731150_4374, protein_id|EMW72988.1, gi|476254221
4691 20925 21854 930 + 19     2: 3 1 dlit(9163511)
dlit(3550695)
dlit(3897211)
dlit(3069843)
Branched-chain amino acid aminotransferase (EC 2.6.1.42) gene_name|ilvE, locus|EC2731150_4375, protein_id|EMW72989.1, gi|476254222
4692 21919 23769 1851 + 64     1: 1 dlit(3550695)
dlit(8325851)
dlit(13727223)
Dihydroxy-acid dehydratase (EC 4.2.1.9) gene_name|ilvD, locus|EC2731150_4376, protein_id|EMW72990.1, gi|476254223
4693 23772 25316 1545 + 2     1: 1 dlit(240428) Threonine dehydratase biosynthetic (EC 4.3.1.19) locus|EC2731150_4377, protein_id|EMW72991.1, gi|476254224
4694 26261 25368 894 - 51         HTH-type transcriptional regulator IlvY locus|EC2731150_4378, protein_id|EMW72992.1, gi|476254225
4695 26411 27886 1476 + 149     2: 1 2 dlit(2653423)
dlit(15654896)
dlit(9015391)
Ketol-acid reductoisomerase (EC 1.1.1.86) gene_name|ilvC, locus|EC2731150_4379, protein_id|EMW72993.1, gi|476254226

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
PLP_Y_genes El_Yacoubi_Basma_user Branched-chain amino acid aminotransferase (EC 2.6.1.42)
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Branched-chain amino acid aminotransferase (EC 2.6.1.42)


  Protein Sequence

>fig|1116007.3.peg.4691 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
MTTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR
LHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDV
IIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY
QEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQ
VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDK
WGWLDQVNQ

MD5 = 1d3a670d1bfad1175025fba33bbc4a4c


  DNA Sequence

>fig|1116007.3.peg.4691 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
atgaccacgaagaaagctgattacatttggttcaatggggagatggttcgctgggaagac
gcgaaggtgcatgtgatgtcgcacgcgctgcactatggcacttcggtttttgaaggcatc
cgttgctacgactcgcacaaaggaccggttgtattccgccatcgtgagcatatgcagcgt
ctgcatgactccgccaaaatctatcgcttcccggtttcgcagagcattgatgagctgatg
gaagcttgtcgtgacgtgatccgcaaaaacaatctcaccagcgcctatatccgtccgctg
atcttcgttggtgatgttggcatgggcgtaaacccgccagcgggatactcaaccgacgtg
attatcgctgctttcccgtggggagcgtatctgggcgcagaagcgctggagcaggggatc
gatgcgatggtttcctcctggaaccgcgcagcaccaaacaccatcccgacggcggcaaaa
gccggtggtaactacctctcttccctgctggtgggtagcgaagcgcgccgccacggttat
caggaaggtatcgcgctggatgtgaatggctacatctctgaaggtgcaggcgaaaacctg
tttgaagtgaaagacggcgtgctgttcaccccaccgttcacctcctccgcgctgccgggt
attacccgtgatgccatcatcaaactggcgaaagagctgggaattgaagtgcgtgagcag
gttctgtcgcgcgaatcactgtacctggcggatgaagtgtttatgtccggtactgcggca
gaaatcacgccagtgcgcagcgtagatggtattcaggttggtgaaggccgttgcggtccg
gttaccaaacgcattcagcaagccttcttcggcctcttcactggcgaaaccgaagataaa
tggggctggttagatcaagttaatcaataa


  DNA with Flanking Sequence

>fig|1116007.3.peg.4691 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
ccacccttactgataaccccgatttcctcatgttagccagcgccttcggcatccctggcc
aacacatcacccgtaaagaccaggttgaagcggcactcgacaccatgctgaacagtgatg
ggccatacctgcttcatgtctcaatcgacgaacttgagaacgtctggccgctggtgccgc
ctggcgccagtaattcagaaatgttggagaaattatcatgatgcaacatcaggtcaatgt
atcggctcgcttcaatccggaaaccttagaacgtgttttacgcgtggtgcgtcatcgtgg
tttccacgtctgctcaatgaatatggctgccgccagcgatgcacaaaatataaatatcga
attgaccgttgccagcccacggtcggtcgacttactgtttagtcagttaaataaactggt
ggacgtcgcacacgttgccatctgccagagcacaaccacatcacaacaaatccgcgcctg
agcgcaaaaggaatataaaaatgaccacgaagaaagctgattacatttggttcaatgggg
agatggttcgctgggaagacgcgaaggtgcatgtgatgtcgcacgcgctgcactatggca
cttcggtttttgaaggcatccgttgctacgactcgcacaaaggaccggttgtattccgcc
atcgtgagcatatgcagcgtctgcatgactccgccaaaatctatcgcttcccggtttcgc
agagcattgatgagctgatggaagcttgtcgtgacgtgatccgcaaaaacaatctcacca
gcgcctatatccgtccgctgatcttcgttggtgatgttggcatgggcgtaaacccgccag
cgggatactcaaccgacgtgattatcgctgctttcccgtggggagcgtatctgggcgcag
aagcgctggagcaggggatcgatgcgatggtttcctcctggaaccgcgcagcaccaaaca
ccatcccgacggcggcaaaagccggtggtaactacctctcttccctgctggtgggtagcg
aagcgcgccgccacggttatcaggaaggtatcgcgctggatgtgaatggctacatctctg
aaggtgcaggcgaaaacctgtttgaagtgaaagacggcgtgctgttcaccccaccgttca
cctcctccgcgctgccgggtattacccgtgatgccatcatcaaactggcgaaagagctgg
gaattgaagtgcgtgagcaggttctgtcgcgcgaatcactgtacctggcggatgaagtgt
ttatgtccggtactgcggcagaaatcacgccagtgcgcagcgtagatggtattcaggttg
gtgaaggccgttgcggtccggttaccaaacgcattcagcaagccttcttcggcctcttca
ctggcgaaaccgaagataaatggggctggttagatcaagttaatcaataaatacaaaaaa
tgggacggcacgcaccgtcccatttacgagacagacactgggagtaaataaagtatgcct
aagtaccgttccgccaccaccactcatggtcgtaatatggcgggtgctcgtgcgctgtgg
cgcgcaaccggaatgaccgatgccgattttggcaagccgattatcgcggttgtgaactcg
ttcacccaatttgtaccgggtcacgtccatctgcgcgatctcggtaaactggtcgccgaa
caaattgaagcggctggcggcgttgccaaagagttcaacaccattgcggtggatgatggg
attgccatgggccacggggggatgctttattcactgccatctcgcgaactgatcgctgat
tccgttgagtatatggtcaacgcccactgcgccgacgccatggtctgcatctctaactgc
gacaaaatcaccccggggatgctgatggcttccctgcgcctgaatattccggtgatcttt
gtttccggcg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(3069843);RossO
evidence_code dlit(3550695);RossO
evidence_code dlit(3897211);RossO
evidence_code dlit(9163511);RossO


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search