The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1081887.3.peg.4542: Escherichia coli 09BKT078844

This feature in The SEED Viewer

NCBI Taxonomy Id: 1081887

Current Assignment: Acetolactate synthase small subunit (EC 2.2.1.6)
Translate Function Assignments



Context on contig AODX01000558 from base 46060 to 57076 (11017 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4537 47553 46060 1494 -           Sensor histidine protein kinase UhpB, glucose-6-phosphate specific (EC 2.7.13.3) locus|EC09BKT78844_5031, protein_id|ELV16644.1, gi|444536641
4538 48152 47562 591 - 8       dlit(11325944) Hexose-phosphate uptake two-component transcriptional response regulator UhpA locus|EC09BKT78844_5032, protein_id|ELV16645.1, gi|444536642
4539 49417 48314 1104 - 161         FIG00638634: hypothetical protein locus|EC09BKT78844_5033, protein_id|ELV16646.1, gi|444536643
4540 50507 50025 483 - 607         hypothetical protein locus|EC09BKT78844_5034, protein_id|ELV16647.1, gi|444536644
4541 51278 50655 624 - 147         FIG00639144: hypothetical protein locus|EC09BKT78844_5035, protein_id|ELV16648.1, gi|444536645
4542 51861 51571 291 - 292     1: 1 dlit(2989782) Acetolactate synthase small subunit (EC 2.2.1.6) locus|EC09BKT78844_5036, protein_id|ELV16649.1, gi|444536646
4543 53553 51865 1689 - 3     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|EC09BKT78844_5037, protein_id|ELV16650.1, gi|444536647
4544 54456 54286 171 - 732         hypothetical protein locus|EC09BKT78844_5038, protein_id|ELV16651.1, gi|444536648
4545 54739 55875 1137 + 282         Multidrug resistance protein D gene_name|emrD, locus|EC09BKT78844_5039, protein_id|ELV16652.1, gi|444536649
4546 56380 55883 498 - 7         Uncharacterized protein YidF locus|EC09BKT78844_5040, protein_id|ELV16653.1, gi|444536650
4547 56739 56377 363 - -4         Inner membrane protein YidG gene_name|yidG, locus|EC09BKT78844_5041, protein_id|ELV16654.1, gi|444536651
4548 57076 56729 348 - -11         Inner membrane protein YidH locus|EC09BKT78844_5042, protein_id|ELV16655.1, gi|444536652

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Acetolactate synthase small subunit (EC 2.2.1.6)


  Protein Sequence

>fig|1081887.3.peg.4542 Acetolactate synthase small subunit (EC 2.2.1.6)
MQNTTHDNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQ
RLEQMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ

MD5 = 8ef52e4ae7b1adaf3a97b79e67a3d302


  DNA Sequence

>fig|1081887.3.peg.4542 Acetolactate synthase small subunit (EC 2.2.1.6)
atgcaaaacacaactcatgacaacgtgattctggaactcaccgttcgcaaccatccgggc
gtaatgacccacgtttgtggcctttttgcccgccgcgcttttaacgttgaaggcattctt
tgtctgccgattcaggacagcgacaaaagccatatctggctactggtcaatgacgaccag
cgtctggagcagatgataagccaaatcgataagctggaagatgtggtgaaagtgcagcgt
aatcagtccgatccgacgatgtttaacaagattgcagtgttttttcagtaa


  DNA with Flanking Sequence

>fig|1081887.3.peg.4542 Acetolactate synthase small subunit (EC 2.2.1.6)
cggcgcaggcttatccgctcaatcgcccacgccagtggctgacctccggcgggctgggca
cgatgggttttggcctgcctgcggcgattggcgcggcgctggcgaacccggatcgcaaag
tgttgtgtttctccggcgatggcagcctgatgatgaatattcaggagatggcgaccgcca
gcgaaaaccagctggatgttaaaatcattctgatgaacaacgaagcgctggggctggtgc
atcagcaacagagtctgttctacaagcagggcgtttttgccgctacctatccgggaaaaa
tcaactttatgcagattgccgccggattcggcctcgaaacctgtgatttgaataacgaag
ccgatccgcaggctgcattgcaggaaatcatcaatcgccctggtccggcgctgatccatg
tgcgcattgatgccgaagaaaaagtgtacccgatggtgccgccaggtgcggcgaatacag
aaatggtgggggaataagccatgcaaaacacaactcatgacaacgtgattctggaactca
ccgttcgcaaccatccgggcgtaatgacccacgtttgtggcctttttgcccgccgcgctt
ttaacgttgaaggcattctttgtctgccgattcaggacagcgacaaaagccatatctggc
tactggtcaatgacgaccagcgtctggagcagatgataagccaaatcgataagctggaag
atgtggtgaaagtgcagcgtaatcagtccgatccgacgatgtttaacaagattgcagtgt
tttttcagtaaggagcgacattaaaccgctcgggggagttactgatgagcgatttttgat
agatccgtgcagatatatagggtgaaattgtgccagagaccatctcaggcacaatttatt
agcccaggacgttaatttaagtcgcagcaccggtaacctgggggggacagttagggctaa
aattttcagcgatggtgttaaattctgattgctgtctataccagtggtcatgaccagcat
tctattaattaatggttcatcgtgaggtatattatggcaagtcctataaacagcggaata
atgatggcaaatctctgcccttccacctttttggataaaaatagaaatgtcgctgctgag
cttgatattaaaaataacgagaaaaaatattcacctggcagtaatttcgcaaaatggatg
ttgcaggaaataaagcgcttaatactaaacatcatgtccggttctcggagtattaacacc
gatattcttgactatttccaccctatgccag


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(2989782);RossO


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search