The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1028799.3.peg.2086: Staphylococcus aureus subsp. aureus VC40

This feature in The SEED Viewer

NCBI Taxonomy Id: 1028799

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig CP003033 from base 2258029 to 2269341 (11313 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2081 2259633 2258029 1605 -           PTS system, maltose-specific IIC component / PTS system, maltose-specific IIB component (EC 2.7.1.69) locus|SAVC_10480, protein_id|AEZ38248.1, gi|374364143
2082 2259963 2260727 765 + 329         phosphosugar-binding transcriptional regulator locus|SAVC_10485, protein_id|AEZ38249.1, gi|374364144
2083 2261291 2260785 507 - 57         hypothetical protein locus|SAVC_10490, protein_id|AEZ38250.1, gi|374364145
2084 2262771 2261458 1314 - 166     1: 2   Methionine transporter MetT locus|SAVC_10495, protein_id|AEZ38251.1, gi|374364146
2085 2262749 2262913 165 + -23         FIG01108368: hypothetical protein  
2086 2263565 2262996 570 - 82         hypothetical protein locus|SAVC_10500, protein_id|AEZ38252.1, gi|374364147
2087 2264933 2264052 882 - 486         Putative oxidoreductase locus|SAVC_10505, protein_id|AEZ38253.1, gi|374364148
2088 2266165 2265044 1122 - 110     1: 4   N-acetyl-L,L-diaminopimelate deacetylase (EC 3.5.1.47) locus|SAVC_10510, protein_id|AEZ38254.1, gi|374364149
2089 2267680 2266442 1239 - 276     1: 1   Imidazolonepropionase (EC 3.5.2.7) locus|SAVC_10515, protein_id|AEZ38255.1, gi|374364150
2090 2269341 2267680 1662 - -1     2: 3 1   Urocanate hydratase (EC 4.2.1.49) locus|SAVC_10520, protein_id|AEZ38256.1, gi|374364151

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1028799.3.peg.2086 hypothetical protein
MALIVSRAILFLILALAFGIATVFPEQKLPLYIVFTLFVAVAIVSNVWFTHQNVKKHIIK
FNKYVAYFLSFVSGLLYIGFVIYTLTIGSYDVLPIIIFAISIVLVQILENILGISIKNTR
LSNKQLKVISKQRVQQFKVISLILVSVSIVFIFIALMLKWWLLLVISIIVLIIITVAMIV
YEKYYTTPD

MD5 = 81d8dc653f5c732245c4b46b9d6af78e


  DNA Sequence

>fig|1028799.3.peg.2086 hypothetical protein
atggcattaatagtatctagagctatattatttttgattttagcattagcttttggaata
gcgactgtttttcctgaacaaaaattaccattatatatagtattcacattatttgtagca
gttgcgatcgtttcgaatgtatggtttacacatcaaaacgttaaaaagcatatcattaag
tttaacaaatacgtcgcatactttttatcctttgtctcagggttactttacattggattt
gtaatttatacattaactatagggagctatgatgttttaccaattattatatttgcaata
agtatcgtattggttcaaatattagaaaatatactgggaatcagtataaaaaatacgcgt
ctatcaaacaaacagttgaaagtcatctccaagcaacgtgttcagcaatttaaagtcata
tcattaatattagtaagtgtgtctatcgtgttcatttttattgcattaatgcttaaatgg
tggcttttacttgttattagcattattgttttgattattattacagtagcaatgattgtt
tatgaaaaatattatacgactcctgattaa


  DNA with Flanking Sequence

>fig|1028799.3.peg.2086 hypothetical protein
tgcaaatagattaggtttgtatgaagcttttaattgaacaacataatattaatttagtta
cttcaatccattaaattaaaatgaattggtgaagtgtattttaaatagtcggtaaaggtg
tgtatctttatcggcttattttaatactctgtcataaggagcgtttgctcagggtgtgga
ttataagttttaagcagaataaactttcttaatgaggatgtcaggacaacaacgaaaaag
ttaaaaactgttgcgggattgggtttagggacggttagtggaagaaagttaaattcatta
acaagtgaaatgcctaaggctagatattaaacgtcagaacggacaaagaataataggata
tgttttcaattaaatagcgaagtatttatatgttaagatgatgtaaattacatagaaacg
ctacccgtagaagtactgatcatagaaacgctgataaacgtaaatttgcaaactcgatat
taaacaaaggggttgttattatggcattaatagtatctagagctatattatttttgattt
tagcattagcttttggaatagcgactgtttttcctgaacaaaaattaccattatatatag
tattcacattatttgtagcagttgcgatcgtttcgaatgtatggtttacacatcaaaacg
ttaaaaagcatatcattaagtttaacaaatacgtcgcatactttttatcctttgtctcag
ggttactttacattggatttgtaatttatacattaactatagggagctatgatgttttac
caattattatatttgcaataagtatcgtattggttcaaatattagaaaatatactgggaa
tcagtataaaaaatacgcgtctatcaaacaaacagttgaaagtcatctccaagcaacgtg
ttcagcaatttaaagtcatatcattaatattagtaagtgtgtctatcgtgttcattttta
ttgcattaatgcttaaatggtggcttttacttgttattagcattattgttttgattatta
ttacagtagcaatgattgtttatgaaaaatattatacgactcctgattaatttatgattg
acgtactaaggattatcttgtaacgtaaacgtaaataagcatcacttatctagagaggtg
gagggactggccctatgaagcctcggcaacatctcgaatgtgccaattccagtaaccgta
atggtttgaagataagcaggtaaagcacatgaaaacctctttcttcatcgtttgtgagaa
agaggtatttttaattggaaagcaggtaaaaaggatggaagtacataaaaagagcaatgc
ttgggcattattccccttgttattatttgtggcgttgtttttaggcgtaggtattatcac
aggtgattttacttcaatgccattaaatgttgcaattacgataacggtaattgtggcgtt
attaatgaatcgaaaagaatcatttgctaaaaaagttgaggtcttcacgaaaggtgcagg
ccattcaaacattgttttaatgatgttgatttttattttagcaggtgcattttcaaatac
agctgaaaaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search