The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1005551.3.peg.4526: Escherichia coli EC1866

This feature in The SEED Viewer

NCBI Taxonomy Id: 1005551

Current Assignment: Ketol-acid reductoisomerase (EC 1.1.1.86)
Translate Function Assignments



Context on contig AMVD01000434 from base 5733 to 18839 (13107 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4522 5733 6662 930 +       2: 3 1 dlit(9163511)
dlit(3550695)
dlit(3897211)
dlit(3069843)
Branched-chain amino acid aminotransferase (EC 2.6.1.42) gene_name|ilvE, locus|ECEC1866_4956, protein_id|EKJ21890.1, gi|408304465
4523 6727 8577 1851 + 64     1: 1   Dihydroxy-acid dehydratase (EC 4.2.1.9) gene_name|ilvD, locus|ECEC1866_4957, protein_id|EKJ21891.1, gi|408304466
4524 8580 10124 1545 + 2     1: 1   Threonine dehydratase biosynthetic (EC 4.3.1.19) locus|ECEC1866_4958, protein_id|EKJ21892.1, gi|408304467
4525 11069 10176 894 - 51         Transcriptional regulator IlvY, LysR family gene_name|ilvY, locus|ECEC1866_4959, protein_id|EKJ21893.1, gi|408304468
4526 11219 12694 1476 + 149     2: 1 2   Ketol-acid reductoisomerase (EC 1.1.1.86) gene_name|ilvC, locus|ECEC1866_4960, protein_id|EKJ21894.1, gi|408304469
4527 13021 12740 282 - 45       dlit(8163020) Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8) gene_name|ppiC, locus|ECEC1866_4961, protein_id|EKJ21895.1, gi|408304470
4528 13669 13220 450 - 198         mRNA interferase, programmed cell death toxin MazF locus|ECEC1866_4962, protein_id|EKJ21896.1, gi|408304471
4529 13886 15907 2022 + 216         ATP-dependent DNA helicase Rep gene_name|rep, locus|ECEC1866_4963, protein_id|EKJ21897.1, gi|408304472
4530 17438 15954 1485 - 46       dlit(6130093)
dlit(8394006)
Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (EC 3.6.1.40) @ Exopolyphosphatase (EC 3.6.1.11) gene_name|gppA, locus|ECEC1866_4964, protein_id|EKJ21898.1, gi|408304473
4531 18839 17574 1266 - 135         ATP-dependent RNA helicase RhlB gene_name|rhlB, locus|ECEC1866_4965, protein_id|EKJ21899.1, gi|408304474

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CoA_Test Ketol-acid reductoisomerase (EC 1.1.1.86)
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Ketol-acid reductoisomerase (EC 1.1.1.86)


  Protein Sequence

>fig|1005551.3.peg.4526 Ketol-acid reductoisomerase (EC 1.1.1.86)
MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDSG
LDISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDKQHSDVVHTVQP
LMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKL
VEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQLKEIMAPLF
QKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEGKIGEQEYFDKGVL
MIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYG
NYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNAQLRDLNEAIRSHAIEQVGKKLRGY
MTDMKRIAVAG

MD5 = 8875764abc90441201ba9e7eee04fb6e


  DNA Sequence

>fig|1005551.3.peg.4526 Ketol-acid reductoisomerase (EC 1.1.1.86)
atggctaactacttcaatacactgaacctgcgccagcaactggcacagttgggcaaatgt
cgctttatgggccgcgacgaattcgccgatggcgcgagctaccttcagggtaaaaaagtg
gtcatcgtcggctgtggcgcacagggtctgaaccagggcctgaacatgcgtgattctggt
ctcgatatctcctacgctctgcgtaaagaagcgattgccgagaagcgcgcgtcctggcgt
aaagcgaccgaaaatggttttaaagtgggtacttacgaagaactgatcccacaggcggat
ctggtggttaacctgacgccggacaagcagcactctgatgtagtgcacaccgtacagcca
ctgatgaaagacggcgcggcgctgggttactcgcatggtttcaacatcgtcgaagtgggc
gagcagatccgtaaagacatcaccgtagtaatggttgcgccgaaatgcccaggcaccgaa
gtacgtgaagagtacaaacgtggattcggcgtaccgacgctgattgccgttcacccggaa
aacgatccgaaaggcgaaggcatggcgatcgctaaagcatgggcggcggcaaccggtggt
catcgtgcgggcgtgctggaatcctctttcgttgcggaagtgaaatctgacctgatgggc
gagcaaaccattctgtgcggtatgttgcaggccggctctctgctgtgcttcgacaagctg
gtggaagaaggcaccgatccggcatacgcagaaaaactgattcagttcggctgggaaacc
atcaccgaagcgctgaaacagggcggcatcaccctgatgatggaccgtctctctaacccg
gcgaaactgcgcgcttacgcgttgtcagaacagctgaaagagatcatggcaccgctgttc
cagaaacatatggacgacatcatctccggcgaattctcctccggcatgatggcggactgg
gccaacgatgataagaaactgctgacctggcgtgaagagaccggcaaaaccgcgtttgaa
accgcgccgcagtatgaaggcaaaatcggcgagcaggagtacttcgataaaggcgtactg
atgatcgcgatggtgaaagcgggcgttgagctggcgtttgaaaccatggttgattccggc
atcatcgaagaatctgcttactatgaatcactgcacgaactgccgctgattgccaacacc
atcgcccgtaagcgtctgtacgaaatgaacgtggttatctctgataccgctgagtacggt
aactatctgttctcttacgcttgtgtgccgttgctgaaaccgtttatggcagagctgcaa
ccgggcgatttgggtaaagctattccggaaggtgcggtagataacgcgcaactgcgtgat
ttgaacgaagcgattcgcagccatgcgattgagcaggtaggtaagaaactgcgcggctac
atgactgatatgaaacgtattgctgttgcgggttaa


  DNA with Flanking Sequence

>fig|1005551.3.peg.4526 Ketol-acid reductoisomerase (EC 1.1.1.86)
gtgttccgcgcggaagcgatccagaatcggcggcagatggctgtaggcagcggtcaccga
gcagaagatatgtaattcgccagagagcgacggcccttgctgatcgatggtgtggcgcag
ctgctgatactgcaacagcgtttgctgggcgaaaacgcgcagttcttcgcccgcttcagt
cagcgtcaccgtgcggttatcgcgcacaaacagcggctgaccgagatcttcttccaggcg
ctgaatctgccgtgagagcgtggatgggctaacgtgcatcgcccgcgcgctgcggccaaa
atggcggctttccgccagatgcaggaaggttttcagatcgcgtaaatccacagggacagc
cctcgatgttgacgttgcaaaaattgcaatatgatgttgtgaatatatcaatttccgcaa
taaatttcctgtcatatagtgaattcaatcttgcaaacgcgaaccgaacaataagaagca
caacatcacgaggaatcaccatggctaactacttcaatacactgaacctgcgccagcaac
tggcacagttgggcaaatgtcgctttatgggccgcgacgaattcgccgatggcgcgagct
accttcagggtaaaaaagtggtcatcgtcggctgtggcgcacagggtctgaaccagggcc
tgaacatgcgtgattctggtctcgatatctcctacgctctgcgtaaagaagcgattgccg
agaagcgcgcgtcctggcgtaaagcgaccgaaaatggttttaaagtgggtacttacgaag
aactgatcccacaggcggatctggtggttaacctgacgccggacaagcagcactctgatg
tagtgcacaccgtacagccactgatgaaagacggcgcggcgctgggttactcgcatggtt
tcaacatcgtcgaagtgggcgagcagatccgtaaagacatcaccgtagtaatggttgcgc
cgaaatgcccaggcaccgaagtacgtgaagagtacaaacgtggattcggcgtaccgacgc
tgattgccgttcacccggaaaacgatccgaaaggcgaaggcatggcgatcgctaaagcat
gggcggcggcaaccggtggtcatcgtgcgggcgtgctggaatcctctttcgttgcggaag
tgaaatctgacctgatgggcgagcaaaccattctgtgcggtatgttgcaggccggctctc
tgctgtgcttcgacaagctggtggaagaaggcaccgatccggcatacgcagaaaaactga
ttcagttcggctgggaaaccatcaccgaagcgctgaaacagggcggcatcaccctgatga
tggaccgtctctctaacccggcgaaactgcgcgcttacgcgttgtcagaacagctgaaag
agatcatggcaccgctgttccagaaacatatggacgacatcatctccggcgaattctcct
ccggcatgatggcggactgggccaacgatgataagaaactgctgacctggcgtgaagaga
ccggcaaaaccgcgtttgaaaccgcgccgcagtatgaaggcaaaatcggcgagcaggagt
acttcgataaaggcgtactgatgatcgcgatggtgaaagcgggcgttgagctggcgtttg
aaaccatggttgattccggcatcatcgaagaatctgcttactatgaatcactgcacgaac
tgccgctgattgccaacaccatcgcccgtaagcgtctgtacgaaatgaacgtggttatct
ctgataccgctgagtacggtaactatctgttctcttacgcttgtgtgccgttgctgaaac
cgtttatggcagagctgcaaccgggcgatttgggtaaagctattccggaaggtgcggtag
ataacgcgcaactgcgtgatttgaacgaagcgattcgcagccatgcgattgagcaggtag
gtaagaaactgcgcggctacatgactgatatgaaacgtattgctgttgcgggttaatagc
gattcagagttcaaggccttctcccggagaaggccttgctattagttacggtacagcacc
ttaatgatgtggtaaccgaactgggtgtgcagcgggccggttggctccagtaccggacaa
gagaacacaactttatcgaacgccggaaccatctgaccctggcggaattcacctaaatca
ccgccgcgtttgcctgatgggcaaatggagtgtttcttcgccagcttgccaaaatcggcc
ccgttcttaatctgctcgagaagatccagagccagtttctcttcttttacaaggatatgc
agtgctgctgctgtttttgccatgatcgtgccttgagtgaataattgtcaggcggcgatt
ttagcatgatccgccgatgctaacgtaattgtcagtcagggaggggctggtacatatatg
gcaaaagcccggaaaatccgggcttcgcaggtccctcaaggggagaaaacttagggcctc
tatgggctacaaagtc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search