The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1005469.3.peg.4159: Escherichia coli 10.0821

This feature in The SEED Viewer

NCBI Taxonomy Id: 1005469

Current Assignment: Branched-chain amino acid ABC transporter, ATP-binding protein LivG
Turn Off Function Translation



Context on contig AMTO01000091 from base 116789 to 127597 (10809 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4153 117634 116789 846 -           Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), permease protein UgpE locus|EC100821_4102, protein_id|EKK83635.1, gi|408610261
4154 118518 117631 888 - -4         Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), permease protein UgpA locus|EC100821_4103, protein_id|EKK83636.1, gi|408610262
4155 119932 118616 1317 - 97       dlit(3062310)
dlit(8407831)
Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), substrate-binding protein UgpB locus|EC100821_4104, protein_id|EKK83637.1, gi|408610263
4156 121038 120292 747 - 359         Putative membrane protein locus|EC100821_4106, protein_id|EKK83639.1, gi|408610265
4157 121055 121168 114 + 16         FIG00640688: hypothetical protein locus|EC100821_4107, protein_id|EKK83640.1, gi|408610266
4158 121870 121157 714 - -12     1: 1   Branched-chain amino acid ABC transporter, ATP-binding protein LivF gene_name|livF, locus|EC100821_4108, protein_id|EKK83641.1, gi|408610267
4159 122639 121872 768 - 1     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, ATP-binding protein LivG locus|EC100821_4109, protein_id|EKK83642.1, gi|408610268
4160 123913 122636 1278 - -4     1: 1   Branched-chain amino acid ABC transporter, permease protein LivM locus|EC100821_4110, protein_id|EKK83643.1, gi|408610269
4161 124836 123910 927 - -4     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, permease protein LivH gene_name|livH, locus|EC100821_4111, protein_id|EKK83644.1, gi|408610270
4162 125993 124884 1110 - 47     1: 1   Leucine-specific ABC transporter, substrate-binding protein LivK gene_name|livK, locus|EC100821_4112, protein_id|EKK83645.1, gi|408610271
4163 126282 126145 138 - 151         FIG00638710: hypothetical protein locus|EC100821_4113, protein_id|EKK83646.1, gi|408610272
4164 126417 126800 384 + 134         Acetyl-CoA sensor PanM, required for maturation of L-aspartate decarboxylase locus|EC100821_4114, protein_id|EKK83647.1, gi|408610273
4165 127324 126797 528 - -4         FIG001353: Acetyltransferase locus|EC100821_4115, protein_id|EKK83648.1, gi|408610274
4166 127597 127331 267 - 6         hypothetical protein locus|EC100821_4116, protein_id|EKK83649.1, gi|408610275

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Branched-chain amino acid ABC transporter, ATP-binding protein LivG (TC 3.A.1.4.1)


  Protein Sequence

>fig|1005469.3.peg.4159 Branched-chain amino acid ABC transporter, ATP-binding protein LivG
MSQPLLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGG
TILLRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKT
PSFRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEP
AAGLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQ
IRNNPDVIRAYLGEA

MD5 = 5ae0816c961f60a72196781e72d7205e


  DNA Sequence

>fig|1005469.3.peg.4159 Branched-chain amino acid ABC transporter, ATP-binding protein LivG
atgagtcagccattattatctgttaacggcctgatgatgcgcttcggcggcctgctggct
gtgaataacgtcaatcttgaattgtacccgcaggagatcgtctcgttaatcggtcctaac
ggtgccggaaaaaccacggtctttaactgcctgaccggattctacaaacccaccggcggc
actattttactgcgcgatcagcatctggagggtttgccggggcagcaaatcgcccgcatg
ggcgtggtgcgtaccttccagcatgtgcgtctgttccgcgaaatgacggtaattgaaaac
ctgctggtggcgcagcatcagcaactgaaaaccgggctgttctctggcctgttgaaaacg
ccttctttccgtcgcgcccaaagtgaagcgctcgaccgcgccgccacctggcttgagcgc
attggtttgctggaacacgccaaccgtcaggcgagtaacctggcctacggtgaccagcgc
cgtctggagattgcccgctgcatggtgacgcagccggagattttaatgctcgacgaacct
gcggcaggtcttaacccgaaagaaacgaaagagctggatgagctgattgccgaactgcgc
aatcatcacaacaccactatcttgttgattgaacacgatatgaagctggtgatgggaatt
tcggaccgaatttacgtggtcaatcaggggacgccgctggcaaacggtacgccggagcaa
atccgtaataacccggacgtgatccgtgcctatttaggtgaggcataa


  DNA with Flanking Sequence

>fig|1005469.3.peg.4159 Branched-chain amino acid ABC transporter, ATP-binding protein LivG
gatcgtgtcattttcctctacctggtggcgttgctgctggtggtgctaagcctgtttgtc
attaaccgcctgctgcggatgccgctgggtcgcgcctgggaagcgttgcgtgaagatgaa
atcgcctgccgttcgctgggcttaagcccgcgtcgtatcaagctgactgcctttaccatc
agcgccgcgtttgccggttttgccggaacgctgtttgctgcgcgtcagggctttgtcagc
ccggaatccttcacctttgccgaatcggcgtttgtgctggcgatagtggtgctcggcggt
atgggctcgcaatttgcggtaattctggcggcaattttgctggtggtgtcgcgcgagttg
atgcgtgatttcaacgaatacagcatgttaatgctcggtggtttgatggtgctgatgatg
atctggcgtccgcagggcttgctgcccatgacgcgcccgcaactgaagctgaaaaacggc
gcagcgaaaggagagcaggcatgagtcagccattattatctgttaacggcctgatgatgc
gcttcggcggcctgctggctgtgaataacgtcaatcttgaattgtacccgcaggagatcg
tctcgttaatcggtcctaacggtgccggaaaaaccacggtctttaactgcctgaccggat
tctacaaacccaccggcggcactattttactgcgcgatcagcatctggagggtttgccgg
ggcagcaaatcgcccgcatgggcgtggtgcgtaccttccagcatgtgcgtctgttccgcg
aaatgacggtaattgaaaacctgctggtggcgcagcatcagcaactgaaaaccgggctgt
tctctggcctgttgaaaacgccttctttccgtcgcgcccaaagtgaagcgctcgaccgcg
ccgccacctggcttgagcgcattggtttgctggaacacgccaaccgtcaggcgagtaacc
tggcctacggtgaccagcgccgtctggagattgcccgctgcatggtgacgcagccggaga
ttttaatgctcgacgaacctgcggcaggtcttaacccgaaagaaacgaaagagctggatg
agctgattgccgaactgcgcaatcatcacaacaccactatcttgttgattgaacacgata
tgaagctggtgatgggaatttcggaccgaatttacgtggtcaatcaggggacgccgctgg
caaacggtacgccggagcaaatccgtaataacccggacgtgatccgtgcctatttaggtg
aggcataagatggaaaaagtcatgttgtcctttgacaaagtcagcgcccactacggcaaa
atccaggcgctgcatgaggtgagcctgcatatcaatcagggcgagattgtcacgctgatt
ggcgcgaacggggcggggaaaaccaccttgctcggcacgttatgcggcgatccgcgcgcc
accagcgggcgaattgtgtttgatgataaagacattaccgactggcagacggcgaaaatc
atgcgcgaagcggtagcgattgtcccggaagggcgtcgcgtcttctcgcggatgacggtg
gaagagaacctggcgatgggcggcttttttgccgaacgtgatcagtttcaggagcgcata
aagtgggtgtatgagctgtttccacgtcttcatgagcgtcgtgttcagcgggcaggcacc
atgtccggcggtgaacagcagatgctggcgattggtcgcgcgctgatgagcaatccgcgt
ttgttgttgcttgatgagccatcgctcg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(2195019);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search