The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1005469.3.peg.4159: Escherichia coli 10.0821

This feature in The SEED Viewer

NCBI Taxonomy Id: 1005469

Current Assignment: Branched-chain amino acid ABC transporter, ATP-binding protein LivG
Translate Function Assignments



Context on contig AMTO01000091 from base 116789 to 127597 (10809 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4153 117634 116789 846 -           Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), permease protein UgpE locus|EC100821_4102, protein_id|EKK83635.1, gi|408610261
4154 118518 117631 888 - -4         Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), permease protein UgpA locus|EC100821_4103, protein_id|EKK83636.1, gi|408610262
4155 119932 118616 1317 - 97       dlit(3062310)
dlit(8407831)
Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), substrate-binding protein UgpB locus|EC100821_4104, protein_id|EKK83637.1, gi|408610263
4156 121038 120292 747 - 359         Putative membrane protein locus|EC100821_4106, protein_id|EKK83639.1, gi|408610265
4157 121055 121168 114 + 16         FIG00640688: hypothetical protein locus|EC100821_4107, protein_id|EKK83640.1, gi|408610266
4158 121870 121157 714 - -12     1: 1   Branched-chain amino acid ABC transporter, ATP-binding protein LivF gene_name|livF, locus|EC100821_4108, protein_id|EKK83641.1, gi|408610267
4159 122639 121872 768 - 1     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, ATP-binding protein LivG locus|EC100821_4109, protein_id|EKK83642.1, gi|408610268
4160 123913 122636 1278 - -4     1: 1   Branched-chain amino acid ABC transporter, permease protein LivM locus|EC100821_4110, protein_id|EKK83643.1, gi|408610269
4161 124836 123910 927 - -4     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, permease protein LivH gene_name|livH, locus|EC100821_4111, protein_id|EKK83644.1, gi|408610270
4162 125993 124884 1110 - 47     1: 1   Leucine-specific ABC transporter, substrate-binding protein LivK gene_name|livK, locus|EC100821_4112, protein_id|EKK83645.1, gi|408610271
4163 126282 126145 138 - 151         FIG00638710: hypothetical protein locus|EC100821_4113, protein_id|EKK83646.1, gi|408610272
4164 126417 126800 384 + 134         Acetyl-CoA sensor PanM, required for maturation of L-aspartate decarboxylase locus|EC100821_4114, protein_id|EKK83647.1, gi|408610273
4165 127324 126797 528 - -4         FIG001353: Acetyltransferase locus|EC100821_4115, protein_id|EKK83648.1, gi|408610274
4166 127597 127331 267 - 6         hypothetical protein locus|EC100821_4116, protein_id|EKK83649.1, gi|408610275

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Branched-chain amino acid ABC transporter, ATP-binding protein LivG (TC 3.A.1.4.1)


  Protein Sequence

>fig|1005469.3.peg.4159 Branched-chain amino acid ABC transporter, ATP-binding protein LivG
MSQPLLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGG
TILLRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKT
PSFRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEP
AAGLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQ
IRNNPDVIRAYLGEA

MD5 = 5ae0816c961f60a72196781e72d7205e


  DNA Sequence

>fig|1005469.3.peg.4159 Branched-chain amino acid ABC transporter, ATP-binding protein LivG
atgagtcagccattattatctgttaacggcctgatgatgcgcttcggcggcctgctggct
gtgaataacgtcaatcttgaattgtacccgcaggagatcgtctcgttaatcggtcctaac
ggtgccggaaaaaccacggtctttaactgcctgaccggattctacaaacccaccggcggc
actattttactgcgcgatcagcatctggagggtttgccggggcagcaaatcgcccgcatg
ggcgtggtgcgtaccttccagcatgtgcgtctgttccgcgaaatgacggtaattgaaaac
ctgctggtggcgcagcatcagcaactgaaaaccgggctgttctctggcctgttgaaaacg
ccttctttccgtcgcgcccaaagtgaagcgctcgaccgcgccgccacctggcttgagcgc
attggtttgctggaacacgccaaccgtcaggcgagtaacctggcctacggtgaccagcgc
cgtctggagattgcccgctgcatggtgacgcagccggagattttaatgctcgacgaacct
gcggcaggtcttaacccgaaagaaacgaaagagctggatgagctgattgccgaactgcgc
aatcatcacaacaccactatcttgttgattgaacacgatatgaagctggtgatgggaatt
tcggaccgaatttacgtggtcaatcaggggacgccgctggcaaacggtacgccggagcaa
atccgtaataacccggacgtgatccgtgcctatttaggtgaggcataa


  DNA with Flanking Sequence

>fig|1005469.3.peg.4159 Branched-chain amino acid ABC transporter, ATP-binding protein LivG
gatcgtgtcattttcctctacctggtggcgttgctgctggtggtgctaagcctgtttgtc
attaaccgcctgctgcggatgccgctgggtcgcgcctgggaagcgttgcgtgaagatgaa
atcgcctgccgttcgctgggcttaagcccgcgtcgtatcaagctgactgcctttaccatc
agcgccgcgtttgccggttttgccggaacgctgtttgctgcgcgtcagggctttgtcagc
ccggaatccttcacctttgccgaatcggcgtttgtgctggcgatagtggtgctcggcggt
atgggctcgcaatttgcggtaattctggcggcaattttgctggtggtgtcgcgcgagttg
atgcgtgatttcaacgaatacagcatgttaatgctcggtggtttgatggtgctgatgatg
atctggcgtccgcagggcttgctgcccatgacgcgcccgcaactgaagctgaaaaacggc
gcagcgaaaggagagcaggcatgagtcagccattattatctgttaacggcctgatgatgc
gcttcggcggcctgctggctgtgaataacgtcaatcttgaattgtacccgcaggagatcg
tctcgttaatcggtcctaacggtgccggaaaaaccacggtctttaactgcctgaccggat
tctacaaacccaccggcggcactattttactgcgcgatcagcatctggagggtttgccgg
ggcagcaaatcgcccgcatgggcgtggtgcgtaccttccagcatgtgcgtctgttccgcg
aaatgacggtaattgaaaacctgctggtggcgcagcatcagcaactgaaaaccgggctgt
tctctggcctgttgaaaacgccttctttccgtcgcgcccaaagtgaagcgctcgaccgcg
ccgccacctggcttgagcgcattggtttgctggaacacgccaaccgtcaggcgagtaacc
tggcctacggtgaccagcgccgtctggagattgcccgctgcatggtgacgcagccggaga
ttttaatgctcgacgaacctgcggcaggtcttaacccgaaagaaacgaaagagctggatg
agctgattgccgaactgcgcaatcatcacaacaccactatcttgttgattgaacacgata
tgaagctggtgatgggaatttcggaccgaatttacgtggtcaatcaggggacgccgctgg
caaacggtacgccggagcaaatccgtaataacccggacgtgatccgtgcctatttaggtg
aggcataagatggaaaaagtcatgttgtcctttgacaaagtcagcgcccactacggcaaa
atccaggcgctgcatgaggtgagcctgcatatcaatcagggcgagattgtcacgctgatt
ggcgcgaacggggcggggaaaaccaccttgctcggcacgttatgcggcgatccgcgcgcc
accagcgggcgaattgtgtttgatgataaagacattaccgactggcagacggcgaaaatc
atgcgcgaagcggtagcgattgtcccggaagggcgtcgcgtcttctcgcggatgacggtg
gaagagaacctggcgatgggcggcttttttgccgaacgtgatcagtttcaggagcgcata
aagtgggtgtatgagctgtttccacgtcttcatgagcgtcgtgttcagcgggcaggcacc
atgtccggcggtgaacagcagatgctggcgattggtcgcgcgctgatgagcaatccgcgt
ttgttgttgcttgatgagccatcgctcg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(2195019);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search