The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1005455.3.peg.201: Escherichia coli 6.0172

This feature in The SEED Viewer

NCBI Taxonomy Id: 1005455

Current Assignment: 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)
Translate Function Assignments



Context on contig AMTF01000003 from base 62346 to 76575 (14230 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
196 63956 62346 1611 -       2: 3 2   Thiamin ABC transporter, transmembrane component gene_name|thiP, locus|EC60172_0197, protein_id|EKK37687.1, gi|408561484
197 64915 63932 984 - -25     2: 3 2   Thiamin ABC transporter, substrate-binding component # ThiB gene_name|thiB, locus|EC60172_0198, protein_id|EKK37688.1, gi|408561485
198 65383 65856 474 + 467         FIG00640217: hypothetical protein gene_name|espY2, locus|EC60172_0199, protein_id|EKK37689.1, gi|408561486
199 67743 66085 1659 - 228         SgrR, sugar-phosphate stress, transcriptional activator of SgrS small RNA gene_name|sgrR, locus|EC60172_0200, protein_id|EKK37690.1, gi|408561487
200 68676 68071 606 - 327     1: 1   3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) gene_name|leuD, locus|EC60172_0201, protein_id|EKK37691.1, gi|408561488
201 70087 68687 1401 - 10     1: 1   3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) gene_name|leuC, locus|EC60172_0202, protein_id|EKK37692.1, gi|408561489
202 71181 70090 1092 - 2     1: 1   3-isopropylmalate dehydrogenase (EC 1.1.1.85) gene_name|leuB, locus|EC60172_0203, protein_id|EKK37693.1, gi|408561490
203 72752 71181 1572 - -1     1: 1   2-isopropylmalate synthase (EC 2.3.3.13) gene_name|leuA, locus|EC60172_0204, protein_id|EKK37694.1, gi|408561491
204 73390 73512 123 + 637         hypothetical protein locus|EC60172_0205, protein_id|EKK37695.1, gi|408561492
205 73589 74533 945 + 76         LysR family transcriptional activator LeuO ## leuABCD operon (and possibly CRISPR immunity) locus|EC60172_0206, protein_id|EKK37696.1, gi|408561493
206 74691 74569 123 - 35         FIG00644139: hypothetical protein locus|EC60172_0207, protein_id|EKK37697.1, gi|408561494
207 74851 76575 1725 + 159     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|EC60172_0208, protein_id|EKK37698.1, gi|408561495

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)


  Protein Sequence

>fig|1005455.3.peg.201 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)
MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLRAHGRPVRQPGKTFAT
MDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPYQGIVHVMGPEQGVTLP
GMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRAKTMKIEVQGKAAPGITA
KDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVAPDETTF
NYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQAEEISPQVTWGTNPGQVISV
NDNIPDPASFADPVERASAEKALAYMGLKPGILLTEVAIDKVFIGSCTNSRIEDLRAAAE
IAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNP
GERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIRNIK

MD5 = bb5c4f74bb74ac8a7dadda20f590d8a9


  DNA Sequence

>fig|1005455.3.peg.201 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)
atggctaagacgttatacgaaaaattattcgacgctcacgtagtgtacgaagccgaaaac
gaaaccccgctgttatatatcgaccgccacctggtgcatgaagtgacctcaccgcaggcg
ttcgatggtctgcgcgcccacggtcgcccggtacgtcagccgggcaaaaccttcgccacc
atggatcacaacgtctctacccagactaaagacattaatgcctgcggtgaaatggcgcgc
atccagatgcaggagctgatcaaaaactgcaaagaatttggcgtcgaactgtatgacctg
aatcacccctatcaagggatcgtccacgtaatggggccggaacagggcgtgaccttgccg
gggatgaccattgtctgcggcgactcgcataccgccacccacggcgcgtttggcgcactg
gcctttggtatcggcacttccgaagttgaacacgtactggcaacgcaaaccctgaaacag
ggccgtgcgaagaccatgaaaattgaagtccagggcaaagccgcgccgggcattaccgca
aaagatatcgtgttggcaattatcggtaaaaccggtagcgcaggcggcaccgggcatgtg
gtggagttttgcggcgaagcaatccgtgatttaagcatggaaggtcggatgaccctgtgc
aatatggcaatcgaaatgggcgcgaaagccggtctggttgcacctgacgaaaccaccttt
aactatgtcaaaggccgtctgcatgcgccgaaaggcaaagatttcgacgacgccgttgcc
tactggaaaaccctgcaaaccgacgaaggcgcaactttcgataccgttgtcactttgcag
gcagaagagatttcaccgcaggtcacctggggaactaacccaggccaggtgatttccgtg
aacgacaatattcccgatccggcttcgtttgccgatccggttgaacgcgcgtcggcagaa
aaagcgttggcctatatggggctgaaaccgggtattctgctgaccgaagtggctatcgac
aaagtgtttatcggttcctgcaccaactcacgtattgaagatttacgcgcggcggcggaa
atcgccaaagggcggaaagtcgcgccaggcgtacaggcgctggtggttcccggctctggt
ccggtaaaagcgcaggcggaagcagaaggtctggataaaatctttattgaagccggtttt
gaatggcgcttgcctggctgctcaatgtgtctggcgatgaacaacgaccgtctgaatccg
ggcgaacgttgtgcctccaccagcaaccgtaactttgaaggccgtcaggggcgcggcggg
cgcacgcatctggtcagcccggcaatggctgccgccgcggctgtgaccggccatttcgcc
gacattcgcaacattaaataa


  DNA with Flanking Sequence

>fig|1005455.3.peg.201 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)
ctgcaatcctctattttatggcgtgaaatcgtcaacgagatcgccacggaatacccggat
atcgaactggcgcatatgtacatcgacaacgccaccatgcagctgattaaagatccatca
cagtttgacgttctgctgtgctccaacctgtttggcgacattctgtctgacgagtgcgca
atgatcactggctcgatggggatgttgccttccgccagcctgaacgagcaaggttttgga
ctgtatgaaccggcgggcggctcggcaccagatatcgcaggtaaaaacatcgccaacccg
attgcgcaaattctgtcgctggcactgctgctgcgttacagcctggatgccgatgatgcg
gcttccgccattgaacgcgccattaaccgcgcattagaagaaggcattcgcaccggggat
ttagcccgtggcgctgccgccgttagtaccgatgaaatgggcgatatcattgcccgctat
gtggcagaaggggtgtaatcatggctaagacgttatacgaaaaattattcgacgctcacg
tagtgtacgaagccgaaaacgaaaccccgctgttatatatcgaccgccacctggtgcatg
aagtgacctcaccgcaggcgttcgatggtctgcgcgcccacggtcgcccggtacgtcagc
cgggcaaaaccttcgccaccatggatcacaacgtctctacccagactaaagacattaatg
cctgcggtgaaatggcgcgcatccagatgcaggagctgatcaaaaactgcaaagaatttg
gcgtcgaactgtatgacctgaatcacccctatcaagggatcgtccacgtaatggggccgg
aacagggcgtgaccttgccggggatgaccattgtctgcggcgactcgcataccgccaccc
acggcgcgtttggcgcactggcctttggtatcggcacttccgaagttgaacacgtactgg
caacgcaaaccctgaaacagggccgtgcgaagaccatgaaaattgaagtccagggcaaag
ccgcgccgggcattaccgcaaaagatatcgtgttggcaattatcggtaaaaccggtagcg
caggcggcaccgggcatgtggtggagttttgcggcgaagcaatccgtgatttaagcatgg
aaggtcggatgaccctgtgcaatatggcaatcgaaatgggcgcgaaagccggtctggttg
cacctgacgaaaccacctttaactatgtcaaaggccgtctgcatgcgccgaaaggcaaag
atttcgacgacgccgttgcctactggaaaaccctgcaaaccgacgaaggcgcaactttcg
ataccgttgtcactttgcaggcagaagagatttcaccgcaggtcacctggggaactaacc
caggccaggtgatttccgtgaacgacaatattcccgatccggcttcgtttgccgatccgg
ttgaacgcgcgtcggcagaaaaagcgttggcctatatggggctgaaaccgggtattctgc
tgaccgaagtggctatcgacaaagtgtttatcggttcctgcaccaactcacgtattgaag
atttacgcgcggcggcggaaatcgccaaagggcggaaagtcgcgccaggcgtacaggcgc
tggtggttcccggctctggtccggtaaaagcgcaggcggaagcagaaggtctggataaaa
tctttattgaagccggttttgaatggcgcttgcctggctgctcaatgtgtctggcgatga
acaacgaccgtctgaatccgggcgaacgttgtgcctccaccagcaaccgtaactttgaag
gccgtcaggggcgcggcgggcgcacgcatctggtcagcccggcaatggctgccgccgcgg
ctgtgaccggccatttcgccgacattcgcaacattaaataaggagcacaccatggcagag
aaatttatcaaacacacaggcctggtggttccgctggatgccgccaatgtcgataccgat
gcaatcatcccgaaacagtttttgcagaaagtgacccgtactggttttggcgcgcatctg
tttaacgactggcgttttctggatgaaaaaggccaacagccaaacccggacttcgtgctg
aacttctcgcagtatcagggcgcttccattttgctggcacgagaaaacttcggctgtggc
tcctcgcgtgagcacgcgccctgggcattgaccgactacggttttaaggtggtgattgcg
ccgagttttgctgacatcttctacggcaatagctttaacaaccagctgctgccggtgaaa
ttaagcgacgcagaagtggatgagctgtttgcgctggtgaaagccaatccggggattcat
tttgatgtagacctggaagcgcaagaggtgaaagcgggtgagaaaacctatcgctttacc
a


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search