The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1005401.3.peg.4539: Escherichia coli 90.0039

This feature in The SEED Viewer

NCBI Taxonomy Id: 1005401

Current Assignment: Dihydroxy-acid dehydratase (EC 4.2.1.9)
Translate Function Assignments



Context on contig ANLL01000372 from base 1578 to 12903 (11326 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4535 3098 1578 1521 -           MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein locus|EC900039_4878, protein_id|EKV93001.1, gi|427224288
4536 3689 5335 1647 + 590     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|EC900039_4879, protein_id|EKV92996.1, gi|427224283
4537 5332 5595 264 + -4     1: 1 dlit(3550695) Acetolactate synthase small subunit (EC 2.2.1.6) gene_name|ilvM, locus|EC900039_4880, protein_id|EKV92991.1, gi|427224278
4538 5615 6544 930 + 19     2: 3 1 dlit(9163511)
dlit(3550695)
dlit(3897211)
dlit(3069843)
Branched-chain amino acid aminotransferase (EC 2.6.1.42) gene_name|ilvE, locus|EC900039_4881, protein_id|EKV92995.1, gi|427224282
4539 6609 8459 1851 + 64     1: 1   Dihydroxy-acid dehydratase (EC 4.2.1.9) gene_name|ilvD, locus|EC900039_4882, protein_id|EKV93015.1, gi|427224302
4540 8462 10006 1545 + 2     1: 1   Threonine dehydratase biosynthetic (EC 4.3.1.19) locus|EC900039_4883, protein_id|EKV93005.1, gi|427224292
4541 10951 10058 894 - 51         Transcriptional regulator IlvY, LysR family locus|EC900039_4884, protein_id|EKV92989.1, gi|427224276
4542 11101 12576 1476 + 149     2: 1 2   Ketol-acid reductoisomerase (EC 1.1.1.86) gene_name|ilvC, locus|EC900039_4885, protein_id|EKV93014.1, gi|427224301
4543 12903 12622 282 - 45       dlit(8163020) Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8) gene_name|ppiC, locus|EC900039_4886, protein_id|EKV92992.1, gi|427224279

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Dihydroxy-acid dehydratase (EC 4.2.1.9)


  Protein Sequence

>fig|1005401.3.peg.4539 Dihydroxy-acid dehydratase (EC 4.2.1.9)
MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGKLV
AEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDQIIKLDLVDAMIQGADPKVSDSQ
SDQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHSDRKQLFLNAGKRIV
ELTKRYYEQNDESALPRNIASKAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEIDFTMSD
IDKLSRKVPQLCKVAPSTQKYHMEDVHRAGGVIGILGELDRAGLLNRDVKNVLGLTLPQT
LEQYDVMLTQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRANGCIRSLEHAYSKDG
GLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQDDAVEAILGGKVVAGDVVVIRY
EGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASGGSIGL
IEDGDLIAIDIPNRGIQLQVSDAELAARREAQEARGDKAWTPKNRERQISFALRAYASLA
TSADKGAVRDKSKLGG

MD5 = fe79e52f4039224ce275e9c86188c89a


  DNA Sequence

>fig|1005401.3.peg.4539 Dihydroxy-acid dehydratase (EC 4.2.1.9)
atgcctaagtaccgttccgccaccaccactcatggtcgtaatatggcgggtgctcgtgcg
ctgtggcgcgccaccggaatgaccgacgccgatttcggtaagccgattatcgcggttgtg
aactcgttcacccaatttgtaccgggtcacgtccatctgcgcgatctcggtaaactggtc
gccgaacaaattgaagcggctggcggcgttgccaaagagttcaacaccattgcggtggat
gatgggattgccatgggccacggggggatgctttattcactgccatctcgcgaactgatc
gctgattccgttgagtatatggtcaacgcccactgcgccgacgccatggtctgcatctct
aactgtgacaaaatcaccccggggatgctgatggcttccctgcgtctgaatattccggtg
atctttgtttccggcggcccgatggaggccgggaaaaccaaactgtccgatcagatcatc
aagctcgatctggttgatgcgatgatccagggcgcagacccgaaagtatctgactcccag
agcgatcaggttgaacgttccgcatgcccaacctgcggttcctgctccgggatgtttacc
gctaactcaatgaactgcctgaccgaagcgctgggtctgtcgcagccgggcaacggctcg
ctgctggcaacccactctgaccgtaagcagctgttcctcaatgctggtaaacgcattgtt
gaattgaccaaacgttactacgagcaaaacgacgaaagtgcactgccccgcaatattgct
agcaaagcggcgtttgaaaatgccatgacgctggatatcgcgatgggtggatcgactaac
accgtacttcacctgctggcggcggcgcaggaagcggaaatcgacttcaccatgagtgat
atcgataagctttcccgcaaggttccgcagttatgcaaagtcgcgccgagcacccaaaaa
taccatatggaagatgttcaccgtgctggtggtgttatcggtattctcggcgagctggat
cgtgcggggttactgaaccgtgatgtgaaaaacgtacttggcctgacgttgccgcaaacg
ctggaacaatacgacgttatgctgacccaggatgacgcggtaaaaaatatgttccgcgcc
ggccctgcgggtatccgtaccacccaggcattctcgcaagattgccgttgggatacgctg
gacgacgatcgcgccaatggctgtatccgctcgctggaacacgcctatagcaaagacggc
ggcctggcggtgctctacggtaatttcgcggaaaacggctgcatcgttaaaactgcgggc
gtcgatgacagcatcctcaaattcaccggcccggcgaaagtgtacgaaagccaggacgac
gcggtagaagcgattctcggcggtaaagttgtcgccggagatgtggtagtaattcgctat
gaaggcccaaaaggtggtccggggatgcaggaaatgctctacccaaccagcttcctgaaa
tcaatggggctcggtaaagcctgtgcgctgatcaccgacggtcgtttctctggcggcacc
tctggcctttctatcggccacgtctcaccggaagcggcaagcggcggcagcattggcctg
attgaagacggcgacctgatcgccatcgacattccgaaccgtggcattcagttacaggta
agcgatgccgaactggcggcgcgtcgtgaagcgcaggaagctcggggtgacaaagcttgg
acgccgaaaaatcgtgaacgtcagatctcctttgccctgcgtgcttatgccagcctggca
accagcgccgacaaaggcgcggtgcgcgataaatcgaaactggggggttaa


  DNA with Flanking Sequence

>fig|1005401.3.peg.4539 Dihydroxy-acid dehydratase (EC 4.2.1.9)
tctctcttccctgctggtgggtagcgaagcgcgccgccacggttatcaggaaggtatcgc
gctggatgtgaacggttatatctctgaaggcgcaggcgaaaacctgtttgaagtgaaaga
tggtgtgctgttcaccccaccgttcacctcctccgcgctgccgggtattacccgtgatgc
catcatcaaactggcgaaagagctgggaattgaagtgcgtgagcaggtgctgtcgcgcga
atccttgtacctggcggatgaagtctttatgtccggtacggcggcagaaatcacgccagt
gcgcagtgtagacggtattcaggttggcgaaggccgttgtggcccggtcaccaaacgcat
tcagcaagccttcttcggcctctttaccggcgaaaccgaagataaatggggctggttaga
tcaagttaatcaataaatacaaaaaatgggacggcacgcaccgtcccatttacgagacag
acactgggagtaaataaagtatgcctaagtaccgttccgccaccaccactcatggtcgta
atatggcgggtgctcgtgcgctgtggcgcgccaccggaatgaccgacgccgatttcggta
agccgattatcgcggttgtgaactcgttcacccaatttgtaccgggtcacgtccatctgc
gcgatctcggtaaactggtcgccgaacaaattgaagcggctggcggcgttgccaaagagt
tcaacaccattgcggtggatgatgggattgccatgggccacggggggatgctttattcac
tgccatctcgcgaactgatcgctgattccgttgagtatatggtcaacgcccactgcgccg
acgccatggtctgcatctctaactgtgacaaaatcaccccggggatgctgatggcttccc
tgcgtctgaatattccggtgatctttgtttccggcggcccgatggaggccgggaaaacca
aactgtccgatcagatcatcaagctcgatctggttgatgcgatgatccagggcgcagacc
cgaaagtatctgactcccagagcgatcaggttgaacgttccgcatgcccaacctgcggtt
cctgctccgggatgtttaccgctaactcaatgaactgcctgaccgaagcgctgggtctgt
cgcagccgggcaacggctcgctgctggcaacccactctgaccgtaagcagctgttcctca
atgctggtaaacgcattgttgaattgaccaaacgttactacgagcaaaacgacgaaagtg
cactgccccgcaatattgctagcaaagcggcgtttgaaaatgccatgacgctggatatcg
cgatgggtggatcgactaacaccgtacttcacctgctggcggcggcgcaggaagcggaaa
tcgacttcaccatgagtgatatcgataagctttcccgcaaggttccgcagttatgcaaag
tcgcgccgagcacccaaaaataccatatggaagatgttcaccgtgctggtggtgttatcg
gtattctcggcgagctggatcgtgcggggttactgaaccgtgatgtgaaaaacgtacttg
gcctgacgttgccgcaaacgctggaacaatacgacgttatgctgacccaggatgacgcgg
taaaaaatatgttccgcgccggccctgcgggtatccgtaccacccaggcattctcgcaag
attgccgttgggatacgctggacgacgatcgcgccaatggctgtatccgctcgctggaac
acgcctatagcaaagacggcggcctggcggtgctctacggtaatttcgcggaaaacggct
gcatcgttaaaactgcgggcgtcgatgacagcatcctcaaattcaccggcccggcgaaag
tgtacgaaagccaggacgacgcggtagaagcgattctcggcggtaaagttgtcgccggag
atgtggtagtaattcgctatgaaggcccaaaaggtggtccggggatgcaggaaatgctct
acccaaccagcttcctgaaatcaatggggctcggtaaagcctgtgcgctgatcaccgacg
gtcgtttctctggcggcacctctggcctttctatcggccacgtctcaccggaagcggcaa
gcggcggcagcattggcctgattgaagacggcgacctgatcgccatcgacattccgaacc
gtggcattcagttacaggtaagcgatgccgaactggcggcgcgtcgtgaagcgcaggaag
ctcggggtgacaaagcttggacgccgaaaaatcgtgaacgtcagatctcctttgccctgc
gtgcttatgccagcctggcaaccagcgccgacaaaggcgcggtgcgcgataaatcgaaac
tggggggttaataatggctgactcgcaacccctgtccggtgccccggaaggtgctgaata
tttaagagcggtgctgcgcgcgccggtctacgaagcggcgcaggtcacgccgctacaaaa
aatggaaaagctctcgtctcgtcttgataacgtgattctggtgaagcgcgaagatcgcca
gccagtgcacagctttaagctgcgcggcgcatacgccatgatggcgggcctgacggaaga
acaaaaagcgcacggcgtgatcactgcttctgcgggtaaccacgcgcagggcgtcgcgtt
ttcttctgcgcggttaggcgtgaaggccctgatcgttatgccaaccgccaccgccgacat
caaagtcgacgcggtgcgcggcttcggcggcgaagtgctgctccacggcgcgaactttga
tgaagcgaaagccaaagcgatcgaactgtcacagcagcaggggttcacctgggtgccgcc
gttcgaccatccgatggtgattgccgggcaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search