The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1005399.3.peg.3867: Escherichia coli 89.0511

This feature in The SEED Viewer

NCBI Taxonomy Id: 1005399

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Translate Function Assignments



Context on contig ANLJ01000466 from base 123934 to 135589 (11656 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3863 124323 123934 390 -       2: 1 3 dlit(9484901) 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10) gene_name|tdcF, locus|EC890511_4230, protein_id|EKV74368.1, gi|427204080
3864 126631 124337 2295 - 13         2-ketobutyrate formate-lyase @ Pyruvate formate-lyase (EC 2.3.1.54) locus|EC890511_4231, protein_id|EKV74369.1, gi|427204081
3865 127873 126665 1209 - 33         Acetate kinase (EC 2.7.2.1) @ Propionate kinase (EC 2.7.2.15) locus|EC890511_4232, protein_id|EKV74370.1, gi|427204082
3866 129230 127899 1332 - 25       dlit(9484901) L-threonine transporter, anaerobically inducible locus|EC890511_4233, protein_id|EKV74371.1, gi|427204083
3867 130241 129252 990 - 21     1: 2 dlit(9484901) Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17) locus|EC890511_4234, protein_id|EKV74372.1, gi|427204084
3868 131278 130340 939 - 98       dlit(9484901) Threonine catabolic operon transcriptional activator TdcA locus|EC890511_4235, protein_id|EKV74373.1, gi|427204085
3869 131467 131811 345 + 188         Threonine catabolic operon transcriptional activator TdcR locus|EC890511_4236, protein_id|EKV74374.1, gi|427204086
3870 132067 132606 540 + 255         orf, hypothetical protein locus|EC890511_4237, protein_id|EKV74375.1, gi|427204087
3871 132628 133815 1188 + 21         FIG00638045: hypothetical protein locus|EC890511_4238, protein_id|EKV74376.1, gi|427204088
3872 135589 134444 1146 - 628         Glycerate-2-kinase (EC 2.7.1.165) gene_name|garK, locus|EC890511_4239, protein_id|EKV74377.1, gi|427204089

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Threonine dehydratase, catabolic (EC 4.3.1.19)


  Protein Sequence

>fig|1005399.3.peg.3867 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIR
GAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDY
SAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVI
VPIGGGGLIAGIAVAIKSINPTIRVIGVQSENVHGMAASFHSGEITTHRTTGTLADGCDV
SRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVVTEGAGALACAALLSGKLDQY
IQNRKTVSIISGGNIDLSRVSQITGFVDA

MD5 = 994df575ca9a00e2f723808a842887e5


  DNA Sequence

>fig|1005399.3.peg.3867 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
atgcatattacatacgatctgccggttgctattgatgacattattgaagcgaaacaacga
ctggctgggcgaatttataaaacaggcatgcctcgctccaactattttagtgaacgttgc
aaaggtgaaatattcctgaagtttgaaaatatgcagcgtacgggttcatttaaaattcgt
ggcgcatttaataaattaagttcactgactgatgcggaaaaacgcaaaggcgtggtggcc
tgttctgcgggcaaccatgcgcaaggggtttcgctctcctgcgcgatgctgggtatcgac
ggtaaagtggtgatgccaaaaggcgcgccgaaatccaaagtagcggcaacgtgcgactac
tccgcagaagtcgttctgcatggtgataacttcaacgacactatcgctaaagtgagcgaa
attgtcgaaatggaaggccgtatttttatcccaccttacgatgatccgaaagtgattgct
ggtcagggaacgattggcctggaaattatggaagatctctatgatgtcgataacgtgatt
gtgccaattggtggtggcggtttaattgctggtattgcggtggcaattaaatctattaac
ccgaccattcgtgttattggcgtacagtctgaaaacgttcacggcatggcggcttctttc
cactccggagaaataaccacgcaccgaactaccggcaccctggcggatggttgtgatgtc
tcccgcccgggtaatttaacttacgaaatcgttcgtgaattagtcgatgacatcgtgctg
gtcagcgaagacgaaatcagaaacagtatgattgccttaattcagcgcaataaagtcgtc
accgaaggcgcaggcgctctggcatgtgctgcattattaagcggtaaattagaccaatat
attcaaaacagaaaaaccgtcagtattatttccggcggcaatatcgatctttctcgcgtc
tctcaaatcaccggtttcgttgacgcttaa


  DNA with Flanking Sequence

>fig|1005399.3.peg.3867 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
tcccgaacatgcaccggcaccaccacgctggagtcgttgaagaacgaacagtgggtgttg
ccacaaactaatatggggtactacagcgaactgcttactacgttacaaagaaatggcatc
agtattgaaaacatcgttaaaaccgactcagtcgtgacaatttataatcttgttctcaat
gctgatttcttaactgtaattccttgtgatatgacgtctccttttggttctaatcaattt
attactattccggttgaagaaacattacctgtggcacaatatgccgcggtatggtcgaaa
aattatcgtattaaaaaagcagcatcggttttggtggaattagccaaagagtattcatct
tataatgggtgtagacgaaggcaattaatagaagttggttagttatttgtttttatttaa
acataaataatccacctgtctgtcttgcaggtgtcggttacggttacctacatatttaat
tcaggcgaagaggttttataatgcatattacatacgatctgccggttgctattgatgaca
ttattgaagcgaaacaacgactggctgggcgaatttataaaacaggcatgcctcgctcca
actattttagtgaacgttgcaaaggtgaaatattcctgaagtttgaaaatatgcagcgta
cgggttcatttaaaattcgtggcgcatttaataaattaagttcactgactgatgcggaaa
aacgcaaaggcgtggtggcctgttctgcgggcaaccatgcgcaaggggtttcgctctcct
gcgcgatgctgggtatcgacggtaaagtggtgatgccaaaaggcgcgccgaaatccaaag
tagcggcaacgtgcgactactccgcagaagtcgttctgcatggtgataacttcaacgaca
ctatcgctaaagtgagcgaaattgtcgaaatggaaggccgtatttttatcccaccttacg
atgatccgaaagtgattgctggtcagggaacgattggcctggaaattatggaagatctct
atgatgtcgataacgtgattgtgccaattggtggtggcggtttaattgctggtattgcgg
tggcaattaaatctattaacccgaccattcgtgttattggcgtacagtctgaaaacgttc
acggcatggcggcttctttccactccggagaaataaccacgcaccgaactaccggcaccc
tggcggatggttgtgatgtctcccgcccgggtaatttaacttacgaaatcgttcgtgaat
tagtcgatgacatcgtgctggtcagcgaagacgaaatcagaaacagtatgattgccttaa
ttcagcgcaataaagtcgtcaccgaaggcgcaggcgctctggcatgtgctgcattattaa
gcggtaaattagaccaatatattcaaaacagaaaaaccgtcagtattatttccggcggca
atatcgatctttctcgcgtctctcaaatcaccggtttcgttgacgcttaattaattcgtt
gaggataggatatgagtacttcagatagcattgtatccagccagacaaaacaatcgtcct
ggcgtaaatcagataccacatggacgttaggcttgtttggtacggcaatcggcgccgggg
tgctgttcttccctatccgcgcaggttttggcggactgatcccgattcttctgatgttgg
tattggcataccccatcgcattttattgccaccgggcgctggcgcgtctgtgtctttctg
gctctaacccttccggcaacattacggaaacggtggaagagcattttggtaaaactggcg
gcgtggttatcacgttcctgtacttcttcgcgatttgcccactgctgtggatttatggcg
ttactattaccaatacctttatgacgttctgggaaaaccagctcggctttgcaccgctga
atcgcggctttgtggcgctgttcctgttgctgctgatggctttcgtcatctggtttggta
aggatctgat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(9484901);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search