Query Sequence
>WP_043745375.1
MSVKPPRKFFEPLAIGAPAPYRELPVRLERMIHFFPPHNEKMRAKAAEMGKNVDVLLGNLEDAIPADAKDAARAGFVEVAKAWDNPNTGLWTRVNCLNSPWFLDDMNAIVGEAGNKVDVVMLPKVEGPWDIHYLDQLLAQLEAKHGVKRPIMIHAILETALGVENVAAICQASPRMHGISLGPADLAASRGMKTTRVGGGHPFYGVLEDAAEGKAGRTLFQQDLWHYTVAKMVDACQSAGIKAFYGPFGDFSDDAACEAQFRNAFLLGCAGGWSLHPKQIDIAKKVFSPDVAEVLFAKKILEAMPDGTGAVMIDGKMQDDATWKQAKVMVDLAKAVAAKDPAMAQAYGL
Hit FamilyFIG01304931
Hit Family FunctionL-malyl-CoA/beta-methylmalyl-CoA lyase (EC 4.1.3.-)


back to search