Query Sequence
>WP_043744857.1
MTDVITNILVCGTGGQGVMTAAEILSQAAMARGLDCKKSEVAGMAQRGGVVTSHVRFGKRVWSPVITPGTADILVAFEVAEGSRWADMLRPGGVAMVNTIRLVPPVVSAGLFKYPDDPVAQMRAAGVTVYDFDAGAIARELGDLRLINTIMLGAIADYLPFPAAELEEQIVGRFRERKPAMVEVNQKAFAAGRDAAGSAKAKTSAA
Hit FamilyFIG00042781
Hit Family FunctionIndolepyruvate oxidoreductase subunit IorB (EC 1.2.7.8)


back to search