Query Sequence
>WP_043744492.1
MFKGSITALITPFRNGKVDEKAFQDLVAWQIAEGTHAVVPCGTTGESPTLSHDEHHRVVELCLEVARGKVPVIAGTGSNSTDEAVALTQHARKAGADAALVVAPYYNKPSQEGLFRHFEAIAKSVDIPIIVYNIPGRSVIDISVETFVRLSALPNIAGIKDATADLARPLRIRAALDERLCQLSGEDATAIAFNAQGGVGCISVTSNIAPKLCARMQNAWAAGDLATCNELNKILMPLHDALFCETSPAPVKYAASLLGKSAPDVRLPLVPASENARHRVEAAMKAAGLI
Hit FamilyFIG00019600
Hit Family Function4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)


back to search