Query Sequence
>WP_011386480.1
MNSPRERILARLKAAPQTAAPLRPDWAPPAYDASARKAKFKAMLEASHADVHEVTAADWPQRLKTILANKGVGNMVYAPATPAGRQLADSWAGSGPELLAYDRPVEDFKEVLVAKADAALTTARGGIAQTGSLVLWPTSDEPRLMSLLPPIHVALVEESSLTDSLAETIRVQGWASGMPTNAVLVSGPSKTADIEQTLAYGVHGPKELIVLLIGKD
Hit FamilyFIG00138308
Hit Family FunctionPredicted L-lactate dehydrogenase, hypothetical protein subunit YkgG


back to search