Query Sequence
>WP_011386456.1
MSLTLVVGTKRWSSWSLRAWMALAVTGAPFRQVFIELRQPETKARILEWSPSGKIPMLDDDGIKVWDSLAICEYLAERFPGAKLWPDDREARALARSVSAEMHAGFVPLRSTCPMDVVEDHPMAEIPDDVKADVARVDALWTECRTRFGQGGPYLFGAFTNADAMYAPVVTRIRTYNLPVGPVAGAYCDAIMAHPALQAWVMEARIAG
Hit FamilyFIG00004065
Hit Family FunctionGlutathione S-transferase (EC 2.5.1.18)


back to search