Query Sequence
>WP_011385258.1
MFPFDYLRPQSVAEAVCAHDGEERRYLAGGQSLLAALKLRLAQPSALIDIARLPELAGIHAEAGRLVVGAAVPHAQLAARSTIPALAQLAGSIGDLQVRNMGTLGGALANADPASDHAAGVLGLGAEIRTDRRVIAAADFFLGMFETALEPGELIVSVSYPLPRRASYAKVRNPASGYPVVGVLVAETDDGIRVAVTGAASCPFRLTEFEMALAGDFSPAALEGLTVPVDDLSRDLHASAEYRAALIPVLARRALAQGGGE
Hit FamilyFIG00027048
Hit Family Function4-hydroxybenzoyl-CoA reductase, beta subunit (EC 1.3.99.20)


back to search