Query Sequence
>WP_011385204.1
MDEKRRQFLTLGAGVAAGALLTRAAGAAGPIPNSAAGALRLVTYSAGGVAPRVGVVKASGRVVDLGAAAKARGMALAFDPASMVSLIRAGDFALAQARQLMQEGPETGPLVSEVRLLAPIPEPSRNVYAVGWNYLEHFKEGEAMRLKSADLPEHPVFFTKAVGTVNGPYDPIPYDAAVSTSIDWECELAVIIGKGGKNIAEADAMKHVFGFCVINDTTARDVQQKKHGGQWFKGKSLDGHGPLGPWIVPASDIDHTRVHLITRVNGVVKQDASTEQMYFKVPRIIAELSAGLTLEPGDIIATGTPPGVGGARKPPEFLKPGDVMETEIVEIGLLRNVIGG
Hit FamilyFIG00137538
Hit Family Function2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (EC 5.3.3.-) / 5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68)


back to search