Query Sequence
>WP_011385007.1
MSDADTYARVRQNPKFHELVKKRTRLAVTLSVIVLGSYYAFMMVVAFAPGILRTPLSQGSNLTVGVPVGAAIIVVSWLLTGLYSHFANGEFEELNKDVVREVLE
Hit FamilyFIG00001462
Hit Family FunctionPutative membrane protein, clustering with ActP


back to search