Query Sequence
>WP_011385004.1
MAQAAVKREVTAPWNDPQAVPLIRFEGISKRFGDFTAVEHVDLAIHKGEFFSLLGASGCGKTTLLRMLAGFEIPTTGRILIDGQDVTEVPPYERPVNMMFQSYALFPHMSVADNIAFGLKQDGLAKPVIKDKVAAALELVQMGRFSGRKPHQLSGGQRQRVALARCLAKEPKVVLLDEPLAALDKKLREATQLELVNIQDRVGITFVMVTHDQGEAMTMSSRIGVMNAGCIEQVGSPVDIYEYPGTRFVADFIGAANMFQGSVRGGEGALAIACPELEHDLSVTEAGAVAAGTPVTVMVRPEKVMIARDKPASGLNWAEGVVSDIAYLGDVSIYHVRLASGRKIQALRTNLHHGEESRLTWEDPVFLAWHPADSLVLTK
Hit FamilyFIG00032740
Hit Family FunctionPutrescine transport ATP-binding protein PotG (TC 3.A.1.11.2)


back to search