Query Sequence
>WP_011384970.1
MRKFKAAEYKAVHFDWKVDGKVATLTLNRPDRKNPLTFDSYGELRDLFENMVYADDVKAVIVTGSGGNFCSGGDVHEIIGPLTKMDMPELLEFTRMTGDAVRAMRNAPQPIIAAIDGICAGAGTMLGCASDIRLGTARSKVAFLFVRVGLAGADMGACTLLPRLIGLSRAAELLYTGRAMGGEEAERVGYYNSLHAPEELLDAANKLAQSLANGPTFGHAMTKKMLWQEWNHGLGECIEAEAQAQAICMQTKDFERAYVAFANKQAPVFEGN
Hit FamilyFIG00033206
Hit Family FunctionEnoyl-CoA hydratase (EC 4.2.1.17)


back to search