Query Sequence
>WP_011384540.1
MSGKNKSVADIMAVCQEMFEDLNFTYARKWKDAKPGRKVIGFLPVYSPIEMIHAAGCLPLGIFGGGDQMEVIHGDAYYQSYICRIPRSTIELGVTNRLDFVDGMIFPFVCDVIRNLSGIWKLMFPNVWSKFFDTPQNYDKSIGGTYYIQELHELKEGLETLTGRKISDADIQRSIGLYNENRRLIREVYAFRAKQPWLAPTSEVYVLMRAGLMMDVEEHNQMLKDYMAAAANEDRPKRDNVRISIYGSFCEQPPLNLIKSIEMAGCYVVDDDYSLNNRFLMVDVPTTGNPLEALAMTYLENSVETSCKYVPDGKVKGQFHVDAVKACGAEGVIYATPSFCDPALLDRPMVCNKLSEAGIPYIAFKYAENSGQMQPIREQAGTFADSIKLWS
Hit FamilyFIG00916597
Hit Family FunctionBenzoyl-CoA reductase subunit BadD (EC 1.3.99.15)


back to search