Query Sequence
>WP_011384537.1
MSELITTGVDIGSGCIKTVVFKVNGDKVEWLGKETARIRNRDPFQLTNEAYDHMLKTAGVDRKDVAYVASTGDAENLSFATGHFYSMTTHGRGGLYLNPEARAVLDIGALNGRAIRMDGVGKVLSYKMTSQCASGSGQFLENIARYLGIAQDEIGSLSMKADDPEKVSSICAVLAETDVINMVSRGISASNILKGIHVSMAVRLAKLLKSIGAVDGIVQVTGGLALDTGLVAALNEAAEQEKVNLKAVSHPDSIYAGAIGAALWGAFRHEKLARLGQAA
Hit FamilyFIG00916690
Hit Family FunctionBenzoyl-CoA reductase subunit BadG (EC 1.3.99.15)


back to search