Query Sequence
>WP_011384506.1
MFDLTGKTALVTGASGGIGGAIAKALHARGATVGLHGTRREALDALAAELGERVHVLPANLSDAAAVEQLAKDAEAAMGSVDILVNNAGLTKDGLVLRMKDEDWQTVLDVNLTAAFRLSRAAVKGQMKRRWGRIINITSIVGVTGNPGQVNYAASKAGMIGMSKALAQEVASRNITVNCVAPGFVSSAMTDVLSDEQKTKLNAGIPAGRMGTADEIAAAVVYLASAEAAYVTGQTLHVNGGMAMI
Hit FamilyFIG00621114
Hit Family Function3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)


back to search