Query Sequence
>WP_011384493.1
MTSVPKIELTGVHKAFGPKVVLDGIDLSVARGESVVVIGGSGTGKSVMLKCILGLLRPESGSIRIDGEDVVGMGPKDRDRIMKKFGMLFQGGALFDSLKVWENVAFGLIQGQKMERAKARDIAIEKLAQVGLAASTGELSPSELSGGMQKRVSLARAIATNPEIIFFDEPTTGLDPIMADVINDLIVKCCKEVGATALSITHDMASARKISDRIAMLYKGRLIWVGPAKDIDHSGNEYVDQFIHGRAVGPITMELRA
Hit FamilyFIG00006151
Hit Family FunctionMethionine ABC transporter ATP-binding protein


back to search