Query Sequence
>WP_011384432.1
MDATFFVNVISAGLLTGLVYGLMALGLSVIFGVMRVVNFAHGDMMVVAMYAAFLLFTKLGIEPVPALPLVAGGLFVVGYLLQRFLINHFLGVTEHIQFLLLLSVAMIITNVVLMVFGPDARNIQLDASFESYNLGWLVLDKVRVIAAFTAGGVAALLWAFFRYTTTGTAIRACADNPVGARVVGLDVEKLYAITFGIGTACVGAAGCLLLLLVDVHPHLSSDYTLLGFIIVILGGLGSLGGALLGGILVGLSEALSGVLIAPSLKSMFSFGLLILVLLLRPQGILGKKP
Hit FamilyFIG00791769
Hit Family FunctionNucleoside ABC transporter, permease protein 2


back to search