Query Sequence
>WP_011384429.1
MLEVRDLDLHYGDAQALDGVSLDVAEGEVVAIIGANGAGKTSLIRAIAGMKKPSRGSIRFEGHDIAGRASSRICDLGVAQVAEGRQIFPSMSVRENLEMGAVLPRARSKRKETLERCYEMFPKLKVRSDQAAGTLSGGEQQMLAIGRCLMGQPRLMMFDEPSLGLAPAVVSEMFKIIKTLHAEGMTVILVEQNVSASLKLADRGYVLENGRVVLSGTGSGLLNDDGVRQAYLGL
Hit FamilyFIG00087702
Hit Family FunctionBenzoate transport, ATP binding protein


back to search