Query Sequence
>WP_011384424.1
MNILPDFRTLRPASLSDAVAALAVPGAEPLAGGTDLLPNLRRGLGKPETLVDLTGITGFAAISVGADGTLRIGAGATLEAVAEDARVLASWPVLAQAASLVAGPSHRAAATLGGNLCQDTRCVFYNQSEWWRSGNGFCLKYEGDKCHVVVKSDRCYATYHGDVAPALMVLNASAEVVGPKGVRLVPVADLFVESGAAHLSLDHGEVLAALLVPPATGWTAAYSKVRVRDAIDFPLAGVAVALKRDGNAIAGLRVAMTGTNSAPLMVPTDALWGRPWNDETAEALVQAVRKVSNVLKTTVAGVKYRRRVLLAVARRQMDYLWNGK
Hit FamilyNo hits found for this sequence


back to search