Query Sequence
>WP_011383897.1
MTGALSHLRILDLSRVLAGPWAGQLLADMGAEVLKIEKPGEGDDTRAWGPPFLDADEGRGESAYYLSANRGKHSVTIDFTQPQGQALVRRLVAQCDVVLENFKVGGLAKYGLDYDSLKAIKPDLVYCSITGFGQDGPYAQRAGYDFLVQGMGGLMSLTGTPDGEPMKVGVALTDIFTGMYAGFAVLAALAHRDRTGEGQHIDLALLDVQVAVLANQATNYLVGGVIPKRLGNSHPNIVPYQAFATAEGHIILAIGNDAQFRRFCEVAGHPELGTDPLYATNADRVRHRAILVPVLVEIMTEHDADYWIAELEKAGVPCGPINSLDRVFADPQVKHRGMAVAMEHPQREDLRLVANPIHLSKTPVTYDRPPPLLGADTDDVLARLLGLDEGERAELRSSGVI
Hit FamilyNo hits found for this sequence


back to search