Query Sequence
>WP_011383782.1
MNQFIPRGTSKISARGLNVHYGEKQALHDIDLDIPAGEVTALIGPSGCGKSTFLRCINRMNDMVDGAKVTGSLTLDGSDVYDRSLDVVQLRARVGMVFQKPNPFPKSIYDNVAYGPRIHGLARDQAELDEIVMNSLEKAGLLAEVESRLSESGTGLSGGQQQRLCIARAIAVAPEVILMDEPCSALDPIATAKVEELIDELRDNYTIVIVTHSMQQAARVSQRTAFFHLGKLIEVGGTEEIFTNPKEPLTQGYITGRFG
Hit FamilyFIG00011114
Hit Family FunctionPhosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)


back to search