Query Sequence
>WP_011383259.1
MTGPLSHLRVLDLSRVLAGPWAGQLLADMGAEVIKVERPGEGDDTRGWGPPFLKDGQGGDTGEAAYFLSANRGKRSVTIDFTQAQGQELVRRLAARSDVVLENFKVGGLAKYGLDYASLKAVKPDLVYCSITGFGQDGPYAQRAGYDFLIQGMGGLMSLTGEPGGQPMKVGVALTDIFTGMYAGFAILAALAKRDRTGEGSQIDLALLDVQVAVLANQATNYLVGGATPKRLGNAHPNIVPYQAFATADGHIILAVGNDGQFRRFCHTAGRPELGADPRFATNVERVRNRAELVPLLEALLTSRPSARWIAELEEAGVPCGPINDLANVFADPQVIHRGLRTRLDHPLAGGIDLVANPIRFDGAQALSDRAPPLLGADTAEVLGGWLGMGADEMERLRENGVV
Hit FamilyFIG01324402
Hit Family FunctionCAIB/BAIF family protein


back to search