Query Sequence
>WP_011382701.1
MTFEKTPGWLDWYAGPSKPAFAPPPGAVDAHCHVFGPGDLFPFAPERKYTPCDASKDQLFALRDHLGFARNVVVQATCHGADNRAMVDALKASQGKARGVATVRRSVTDAELAEMNAAGVRGVRFNFVKRLVDFTPKDELMEIASRIAPLGWHVVIYFEAVDLPELWDFFTALPTTVVVDHMGRPDVAKPVDGPEFGLFLKFMRQHGNVWSKVSCPERLSLTGPRALDGERAAYRDVVPFARAVVDEFPDRVLWGTDWPHPNLKDHMPDDGLLVDFIPHIAPTADLQRRLLVDNPMRLYWPEERT
Hit FamilyFIG00121014
Hit Family Function2-pyrone-4,6-dicarboxylic acid hydrolase


back to search