Query Sequence
>WP_011382620.1
MIRLQSYLAGRWQDGAGSGAQLKDPVSGEVLATASGDGLDIAEALAFARDRGGPALRALSFAGRAGLINALAGVLAENRERYNTVALANSGNTAVDAGLDVDGGIGTLKYYASIGRKLGEARLLAEATDDQLTKDEAFRGRHIWTSNRGVAVHINAFNFPSWGLWEKAAVSLLAGVPFLAKPATATSWLAYEMVKDVVAAGVLPEGAMSLLCGGGRDLMDHLKPGDVVAFTGSAETAAQLRSNPNVIAANVRFAVEADSLNLCALGPDAAPDAPEFAAFIKEVSREMTVKAGQKCTAIRRVLVPRSRVDDVVAALKPALAKALMGDPRTEGVRMGPLVSRAQTVAAWAGLEALKAETQVVAGGGNDDGGCFVPATLLLCNDPLAARAVHEIEVFGPVATLMPYDSVEQAVDLAHKGGGSLAASVFSGDAAFLAGFVPAIATSHGRVLVVDSSVAASHSGHGVVMPHCIHGGPGRAGGGEELGGLRGLRFYMQRSAIQGSRSMLDAMTQGAAVVAL
Hit FamilyFIG00455062
Hit Family FunctionBenzaldehyde dehydrogenase


back to search