Query Sequence
>Synpcc7942_2574
MSQASAPNPPTLQAHHLSASYRDREVLQDVNLQLRAGQVVGIVGPNGAGKSTFLKALLGLVPHQGEVFWRGLPLASRLPHVAYVPQRAQVDFDYPATVWDVVLMGRVAQTGWLRRFSAASQQAVKAALDRVELWDLRSRPIGELSGGQQQRVFIARSLAQEAELFLLDEPFAGIDRRSEGLLYEILRDLAQQGHGVVVVHHDLGQAIQQFDELVLLNQRVIAQGHPRLVLQPDHLARAYGARLDITRYEAA
Hit FamilyFIG01743105
Hit Family FunctionProbable ABC transporter ATP-binding protein in ycf23-apcF intergenic region


back to search