Query Sequence
>Synpcc7942_1915
VSWRVKAIRGATTVRENTAEAMREAVSELLDELERRNPLNPDDIVSLTFSVTRDLDAMFPAAVARQRAGWQNVPLLDVQQMYVEGSLERCIRLLLHFNCPEDQPPIEHPYLRGAQVLRPDWVLTESANHR
Hit FamilyFIG00002036
Hit Family FunctionChorismate mutase II (EC 5.4.99.5)


back to search