Query Sequence
>Synpcc7942_1653
MEVSTGYLPQAVFAPADQGHPAPRVFISPQRYIQGRGVLRSVGRYLSLLQAKRAGLLMSQRSSRNEGDLLLAGLRSAGVDAVVSTFQGECTTDEITAHTTAFSKERIDCVIAAGGGKCIDTGKAIAFRLGIPVVVVPTLASNDAPCSALSVLYSPEGISQGVEFYPNSPAIVVVDTDIIAAAPERYLVAGMGDAMATWYEASVCLRNPAAVTTVGARPTLAACAIGEVCAHTLFQEGCAAAAAVASKTVNDALESVVEANTLLSGLGFESGGLAGAHAVAQSYTAIPHVRANYLHGEMVAMGTLAQLMMESRPKEATRVAEFFAAVGLPIHLGQLSLSSSDTQALEIVSEASLGFPFVGNMPMKITPEFVKSAILDAHHLGLSISEQIGDSAYRHLQG
Hit FamilyFIG00132994
Hit Family FunctionGlycerol dehydrogenase (EC 1.1.1.6)


back to search