Query Sequence
>Synpcc7942_1317
MLEIQHLSVCYRQQRVLEDICLQVQAGEQLALIGPNGAGKSTLVRAILGLLTPYAGEVRWRGRPLRRGQRSIAYVPQRSQIDWQYPITVETVVRLGAEVRSWWGRSPQTGSRIAAALEQVQLTELRHRPLAELSGGQQQRVFLARAIAQGADLLLLDEPFTGIDHPTERLMQNLFQQFAQQGKTLIVCSHEWGDALQRYDRLILLNRRIICHDIPDRALTPQNLQQTFGARQPDAPPDRQWGFAC
Hit FamilyFIG00059280
Hit Family FunctionZinc ABC transporter, ATP-binding protein ZnuC


back to search