Query Sequence
>Synpcc7942_0881
MSERAIAHLGPVGTYAEMAALRFQAWLTQQDQQPSRLLACRSIPATLQTLADGAVDYAVVPVENSVEGSVAATLDSLWQLPQLSIQRALILPIAHALISFESDRTAIRQVLSHPQALAQCQQWLQRHLPQAELIPANSTTEALQDLERHPQRAVIASTRAAELYQMPIQSFPINDSPDNRTRFWVISRSPTPGGACTSLNFSLDANVPGALVKPLQILADRRINLSRIESRPTKRSLGEYLFFLDLEADLRDPAIAAAVQAVADCTEQLRVLGSYDSLDFTQSVLVPAQAR
Hit FamilyFIG00341289
Hit Family FunctionPrephenate dehydratase (EC 4.2.1.51)


back to search