Query Sequence
>Synpcc7942_0440
VQSIEPMSQTFDRLPPPQLRMIDLQGDWLSLGGIDLQINGALGLAFPEVQASDRNRLLAICRRLWEQGVDAFTPTLVTSSIAQFRQAIEAIADFVAQPLPPRHAKILGLHLEGPCLAESKRGAHPQEHLQPLTVEVLSEICGDHLAQIRIVTLAPELDPTGEAIAWLRQQGVIVSLGHSQATAEQAQVAFQQGATMVTHAFNAMPPLHHRQPGLLGAALTTDTVFAGLIADGQHIDPIMLKLLLRAGEGDRRLFLVSDALAPLGLPDGQYPWDERQITVTAGTCRLEDGTLAGTTLPLLAGVQNLVRWQVCEPETAIMLATLAPLRALGVDWSDPRLLYLSRPVCQLLRWHQSDTGELTWQRLCENDELPTPTSI
Hit FamilyFIG00076542
Hit Family FunctionN-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)


back to search