Query Sequence
>SMc04289
MKHRAESGGTSRRRFLRGAAAAGAAMAAAPSIVRAQGPVSMRWQSTWPSKDIFHEFALDFAKKVNDMTGGDLKIEVLPAGAVVPAFGLLDAVSEGTLDGGHGVMVYHYGKQTALALWGSGPGFAMDANMMLAWHKYGGGRDLLAKLYESIGANVVSFPYGPMPTQPLGWFKKPVAKAEDLQGLKFRTVGISIDVFTGLGAAVNALPGGEIVAALDRGLLDAAEFNNASSDRLLGFPDVSKVCMLQGYHQNAETFEILFNKGKFDGLPDQMKAIISNAVDAASADMAWKAIDRYSTDYREMQTADQVKFYKTPEAILKRQLEVYDEVVKKKSAENPVFKEVLQSQIAFAERATRWEQDTVVNRRMAFDHYFGRDGVAKSL
Hit FamilyFIG00016663
Hit Family FunctionTRAP-type C4-dicarboxylate transport system, periplasmic component


back to search