Query Sequence
>SMc03813
MQPVRTLTAALSVACLAAGLTAPQANAADREFALVFKVLNNAFSPPIQQGCEAAAKKLGDVTCTYLGPTEYDEAKQVQLAQDMVTRGVAGLGVSAGNPKAMARIMKMAQDKGIPVVTFDTDVLPEDAGLRSTYIGTDNYEFGIALAQKVLESKKDGGTVCIQSGAPASENLKARVQGIRDTLAGVTKDKGAEKLTGQNGWTEPAGCPVYNNDDITLAAQQVRDVMTNNPELSAFVAVGGWAQYAPQAYKQAMEPLKARLDSKDLVVVFGDNFGPQLPLLAEGLSHYNIGQRPYDMGYETIMALDKLTKGEKVEPFIKTGTEVCTPEDALTTCGKTAN
Hit FamilyFIG00437806
Hit Family FunctionNucleoside ABC transporter, permease protein 1


back to search