Query Sequence
>SMc03101
MAKITMTVNGRQVSGTCDDRTLLVHFIRENLGLTGTHVGCETTQCGACVVHMDGQSVKSCSILAAQAAGSAITTIEGLASNGELHPVQAAFKTYHGLQCGFCTPGMVMTAVDMIRRHGGNLDEATVRAELEGNICRCTGYHNIVQAILAAAAETGGARQAAE
Hit FamilyFIG00525841
Hit Family FunctionCarbon monoxide dehydrogenase small chain (EC 1.2.99.2)


back to search