Query Sequence
>SMc02849
MTSKKKPTVYITRKLPDVVETRMRELFDAELNIDDTPRSQPELVAAVKRADVLVPTVTDRIDAALIEQAGPQLKLIAAFSNGVDNIDVDAAARKGITVTNTPNVLTEDTADMTMALILAVPRRLAEGAQVLTDRKGEWAGWSPTWMLGRRIAGKRIGIVGMGRIGTAVARRAKAFGLSIHYHNRHRVKPETEEMLEATYWDSLDQMLARVDIVSVNCPSTPATYHLLSARRLALMRPDSYIVNTARGGIIDEAALIKSLREGKIAGAGLDVFENEPCVNPKLIKLAGEGKVVLLPHMSSATLEGRIDMGEKVVINIRTFFDGHRPPDRVLPGRD
Hit FamilyFIG00133864
Hit Family FunctionGlyoxylate reductase (EC 1.1.1.79) / Glyoxylate reductase (EC 1.1.1.26) / Hydroxypyruvate reductase (EC 1.1.1.81)


back to search