Query Sequence
>SMc02772
MSVETVESAGPTPKKGVSILFGLTLVGLLVVLWLLLGLATNAFWTPNNISNLLRQGAMTAILAVGQTFVIITAGIDLSVGAVVGFTSVIVAWLLAAGVPLWLAIIATLAIGVLIGAFHAFGIVRMGLPPFIITLATLTSLRGIGLLITNGSTISITNDAFTTFSRADFLGIPSLFWMVIVVAIPAYVFLHLSRFGRYLFAVGSNSEAARLSGVNVNRTIYLAYILSSTCAAFVGLLLASRIGIGNATQAEGWELQAIASSVIGGTSLFGAVGSVHGPLLGAFILATINNGANLLNVNSFWQRIITGLLIIVIVYFDQLRRRGAR
Hit FamilyFIG01318826
Hit Family FunctionRibose transport system permease protein rbsC


back to search