Query Sequence
>SMc02568
MTDFTLSDLEKIVATRARAAPEESWTAKLVAAGQTKAAKKLGEEAVETVIAAIGEDRKNLVDESADLLYHLMVVLNIAAVPLQDVMSELARRTSQSGLQEKANRQNP
Hit FamilyFIG00000871
Hit Family FunctionPhosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)


back to search