Query Sequence
>SMc02474
MASVELRDIRKSYAALEVVHGVSLSIAEGEFIALVGPSGCGKSTLLRMIAGLEEISDGEVLIGGKVVNPLTPRERNIAMVFQSYALYPHMSVAENMGFNLKLSGLSRPEIDKKVGEAARMLALTELLDRKPSQLSGGQRQRAAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRTEIKALHQKVATTSIYVTHDQIEAMTLADRIVVLNGGRIEQVGTPLELYRTPANLFVAGFIGSPAMNVLDGTVDADDGEPAVRLGDGSAIRIAPERKVRPGQAVRIGLRPEHFVAGGEGNAIAGQTLLVEPTGAQTHVLFEFAGEQITAVVDGDHPARHGSLFRAAMDRSQVYVFDRQTGAAL
Hit FamilyFIG00450796
Hit Family FunctionABC transporter ATP-binding protein


back to search